KEGG   Amycolatopsis mediterranei S699: RAM_40445Help
Entry
RAM_40445         CDS       T01822                                 

Definition
(GenBank) putative amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00970  Aminoacyl-tRNA biosynthesis
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RAM_40445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:amn03029]
    RAM_40445
Enzymes [BR:amn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RAM_40445
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RAM_40445
Mitochondrial biogenesis [BR:amn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RAM_40445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEK46556
UniProt: G0G6F2
LinkDB All DBs
Position
complement(8658990..8660360)
Genome map
AA seq 456 aa AA seqDB search
MLTASELVAAYATGELSPVEATQNALQAIEARDGECNAFCLVDADRALEQAKASEVRWRD
GNPIGWLDGVPSSIKDMFLTQGWPTVRGSKSIDPDRPWDVDSPVAARMREAGLVLLGKTT
TPEIGWKGVTDSPLCGITRNPADPSKTAGGSSGGSAAAVAAGMGELSVGTDGGGSVRIPA
SFCGIVGLKPTHGRIPLYPASPFGPLSHAGPMARSVDDTALLLDVLSLPDPRDPAALAPP
VGSFREAVRRDVRGLIAAFSPTLGYVDVDPEVAAIVAAAVRALGDAGLHVEETDPGFADP
KPAFDVLWSSGAAKLLDSFPPGSEERTDPGLRRVWELGKKWSASDYLDATAERAALGIRM
GEFHTRYDVLITPTLPIAAFEAGHDVPPGSGLSEWPEWTPFTYPFNMTQQPAISVPAGCT
SAGLPVGLQIVGPRHSDDLVLAVAKLLEEVRPWAPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgccagcgagctcgtcgccgcctacgcgaccggtgagctttcgccggtcgag
gcgacgcagaacgccctgcaggccatcgaagcccgggacggcgagtgcaacgctttctgc
ctcgtcgacgccgatcgcgcgctggagcaggcgaaggcgtccgaggtccgctggcgcgac
ggcaacccgatcgggtggctcgacggcgtgccgtcgtcgatcaaggacatgttcctcacc
cagggctggccgaccgtccggggctcgaagagcatcgatccggaccggccgtgggacgtc
gacagcccggtcgccgcgcggatgcgcgaggccggcctggtgctgctgggcaagacgacc
acgcccgagatcggctggaagggcgtcaccgacagcccgctgtgcggcatcacgcgcaac
ccggccgacccgtcgaagacggcgggcgggtcgagcggcggcagcgccgcggccgtcgcg
gccgggatgggcgagctgtcggtcggcacggacggcggcggctcggtgcggatcccggcg
tcgttctgcggcatcgtcgggctgaagcccacgcacggccggatcccgctctacccggcg
agcccgttcggcccgctctcgcacgccggcccgatggcgcggtcggtggacgacaccgcg
ctgctgctggacgtcctctcgctgcccgacccccgcgacccggccgcgctggcgccgccg
gtggggtcgttccgcgaggccgtccggcgggacgtgcgcggcctgatcgccgcgttctcc
ccgacgctcggctacgtcgacgtggacccggaggtggccgcgatcgtcgcggccgcggtc
cgtgcgctgggggacgccggcctgcacgtcgaggagaccgaccccgggttcgccgacccg
aagccggcgttcgacgtcctgtggtcttcgggggcggcgaagctgctggactcgttcccg
cccgggtccgaggagcggaccgaccccggcctgcgccgggtctgggaactcgggaagaag
tggtcggcgagcgactacctcgacgcgaccgccgagcgcgccgcgctgggtatccggatg
ggcgagttccacacccgctacgacgtgctgatcacgccgacgctgccgatcgcggcgttc
gaggccgggcacgacgtgccgccgggcagcgggctgagcgagtggccggagtggacgccg
ttcacgtacccgttcaacatgacccagcagccggcgatcagcgtgccggccgggtgcacg
tcggcgggactgccggtcggcctgcagatcgtcgggccgcggcactcggacgacctcgtg
ctggccgtggcgaagctgctggaggaagtgcggccctgggcgcccgcctga

DBGET integrated database retrieval system