KEGG   Amycolatopsis mediterranei S699: RAM_45505Help
Entry
RAM_45505         CDS       T01822                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00250  Alanine, aspartate and glutamate metabolism
amn00410  beta-Alanine metabolism
amn00430  Taurine and hypotaurine metabolism
amn00650  Butanoate metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn02024  Quorum sensing
Module
amn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RAM_45505
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RAM_45505
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RAM_45505
   00430 Taurine and hypotaurine metabolism
    RAM_45505
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RAM_45505
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RAM_45505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEK47566
UniProt: G0FKM5
LinkDB All DBs
Position
complement(9721548..9722936)
Genome map
AA seq 462 aa AA seqDB search
MVLHQGKAGRPDRTAGTNPLYAGANPALAAGFVMPHDKLREDSLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDP
GDVMGCSTTGSSEACMLAGMALKRRWSKLGRTGKPNLVMGANVQVCWEKFCEYWEVEPRL
VPMDGDRYHLTADEAVARCDENTIGVVAILGSTFDGSYEPVAEIAAALDSLEERTGWDIP
VHVDGASGAMIAPFLDPHLEWDFRLPRVASINTSGHKYGLVYPGVGWVLWRDKAALPSEL
VFNVNYLGGDMPTFALNFSRPGAEVAAQYYTFVRLGREGFRAVQQASRDVALHLSSGIAS
LGPFSLLTRGDQLPVFAFTTRPDVGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRIV
VRNGFTHDLADLLLADLRRVLPELEQFGGRPKDPAKATAFHH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcatcaggggaaagccggccgcccggaccgcacggcggggacgaacccgctc
tacgccggagcgaatccggcgctcgcggcgggcttcgtcatgccgcacgacaagctgcgt
gaggactcgctgccgccggacaccgcgctgcagctcgtgcgcgacgagctgatgctcgac
ggcaacgcgcggctcaacctcgccaccttcgtcacgacgtggatggagccgcaggcgcgt
gagctgatggccgagtgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacg
gccgagctcgagcggcgctgcgtgaacatcctggccgacctgtggcacgcgcccgacccg
ggcgacgtcatgggctgctcgacgaccgggtcgtcggaagcgtgcatgctcgccgggatg
gcgctgaagcggcgctggtccaagctcgggcgcaccgggaagccgaacctggtgatgggc
gcgaacgtccaggtgtgctgggagaagttctgcgagtactgggaagtcgagccgcggctg
gtcccgatggacggcgaccgctaccacctcaccgccgacgaagccgtggcgcgctgcgac
gagaacaccatcggcgtggtggcgatcctgggctcgacgttcgacggcagttacgagccg
gtcgcggagatcgccgcggccctggactcgctggaagagcgcaccggctgggacatcccg
gtgcacgtcgacggcgcttcgggcgcgatgatcgccccgttcctcgacccgcacctggag
tgggacttccgcctgccgcgcgtggcgtcgatcaacacgtcgggccacaagtacgggctg
gtgtacccgggcgtcggctgggtgctctggcgcgacaaggccgcgctgccgtccgagctg
gtgttcaacgtgaactacctcggcggcgacatgccgacgttcgcgttgaacttctcccgc
ccgggcgccgaggtcgcggcccagtactacacgttcgtccggctcggccgggaagggttc
cgcgcggtgcagcaggcttcgcgtgacgtcgccctgcacttgtcgtccgggatcgcgtcg
ctggggccgttctccttgctgacccgaggtgatcagctgccggtgttcgcgttcaccacc
cgcccggacgtcggcttcgacgtcttcgacgtgtcccgccgactgcgtgagcgcgggtgg
ctggtcccggcgtacacgttccccgagaaccggacggacctggcggtgctgcggatcgtg
gtccgcaacggcttcacacacgacctggcggatctgctgctggcggatttgcggcgggtg
ctcccggagctggagcagttcggcggccgcccgaaggacccggcgaaggcgaccgcgttc
caccactag

DBGET integrated database retrieval system