KEGG   Acetomicrobium mobile: Anamo_1845Help
Entry
Anamo_1845        CDS       T02151                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
Organism
amo  Acetomicrobium mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFM22431
UniProt: I4BYS4
LinkDB All DBs
Position
1866948..1867979
Genome map
AA seq 343 aa AA seqDB search
MENMMKVVYIKSPGNIQILEEPIPTPKKGEALLKVKYCGICGSDVAVYKGKQPFATYPRI
PGHEFSAEIVSIENNGLGLREGMLVTANPYFNCGHCYPCRKGNINCCVNNETMGVQRNGS
FAQYITMPIHRIYSGEGLDAKILAQIEPFCIGFHAVNRANVKEKEKVLVFGAGAIGIFAM
LSAKLKGADVYIADMLQSRLEVARALGANNTLNLTQVDLDKAIYEITEGNGMDVVVEAVG
APKSFLSAINSVAFSGKIVLIGNGTKEVTFNQSVLVKKELNIYGSRNSLPNDFRQLIKLA
KDGLVDTEKIVTDIYNFEDCVQAFLELVNNPGDHLKVLLKFND
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgatgaaagttgtttatattaaatctccaggcaatattcaaatactagaa
gaaccaatccctacaccaaaaaaaggcgaagccttgttaaaagtgaaatattgtggaatt
tgcggatcagacgttgcggtatataaaggaaaacaaccttttgccacctatccaagaata
ccgggtcatgagttttcagctgagattgtttcaattgaaaataatggcttagggttaagg
gaaggaatgttagttacagcaaatccatatttcaattgtggtcactgctatccttgcaga
aagggaaacataaattgttgtgttaataacgaaacgatgggcgttcaacgcaatggctct
tttgctcagtatattacgatgccaattcatcgtatttattcaggcgaagggttagacgca
aaaatactggctcaaattgagcctttttgtataggatttcatgctgtaaatcgcgctaac
gtaaaagagaaagaaaaagttctggtatttggagcaggagctatcggcatctttgcaatg
ctttcagccaaattaaaaggtgctgatgtatatatagctgatatgttgcaatctagatta
gaggtagctcgtgcacttggggctaataatacactcaatttaacacaagttgatctggat
aaagcaatatacgaaatcactgaaggaaatggcatggacgtagttgtagaagcagtgggt
gctcccaagagctttttgagtgccattaactcagttgcctttagcggaaaaatagtactc
ataggaaatggtacaaaagaggtaacttttaatcagtccgttttagtaaaaaaggaatta
aatatttatggatcgagaaatagcctgcctaacgattttagacaactcataaagttagca
aaagacggactcgtggacacagagaaaattgttactgatatttacaactttgaagattgt
gtgcaggcatttttagagttagttaataatcccggagatcacttaaaagttcttttgaaa
ttcaacgattaa

DBGET integrated database retrieval system