KEGG   Anaplasma marginale Gypsy Plains: U128_04835Help
Entry
U128_04835        CDS       T02900                                 

Definition
(GenBank) DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
amp  Anaplasma marginale Gypsy Plains
Pathway
amp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:amp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    U128_04835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amp03400]
    U128_04835
Enzymes [BR:amp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     U128_04835
DNA repair and recombination proteins [BR:amp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     U128_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Nop
Motif
Other DBs
NCBI-ProteinID: AGZ79220
LinkDB All DBs
Position
1102808..1103680
Genome map
AA seq 290 aa AA seqDB search
MRVQDHLQESNMTGKEKDAAVGSGELLEVLKFYHENGVDCVLEEDGPGTCAPPVAALQEQ
EGCTLQVGSPSEQMDAGASQFSTDWVAAAKSIADKCGTLAELREAVEAFEGCEIKKAAMN
TVFSDGNPNAKIMLIGEAPGSNEDREGRPFCGASGMLLDKMLAAIGLDRKSTYISNTTFW
RPPGNRRPTDFELEICKPFVEKHIALIAPSILVLVGSTACCSLLSTPESISRLRGRFHEY
ANPFLAHPIKTAVIFHPAYLLRQPMQKRLAWEDLKMIRSHIENEKITVDA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgttcaagatcatttgcaggagagtaacatgacaggaaaagaaaaagacgcggcg
gttggcagtggagagctgcttgaggtattgaaattctaccacgaaaatggggtagactgc
gtgctggaggaagatgggcccggaacatgcgcgcctcccgtggcggcgctgcaagaacaa
gaagggtgcacactacaggtcggcagtccctcggaacagatggatgcgggcgcaagtcag
ttttcaaccgattgggtcgctgcagccaagagcattgccgacaaatgcggcaccctagca
gagttgagagaggcagttgaggccttcgagggatgcgaaatcaaaaaagctgccatgaac
acggtgttttcggacggcaacccaaacgccaagattatgctgatcggggaggcaccgggt
agcaacgaagatcgcgagggccggccgttttgtggggctagcggtatgttgcttgataaa
atgctcgcggctattggtttggaccgaaaaagtacttacatcagcaacacaacgttttgg
cgcccccctggaaatcgacgtccgactgattttgagctggaaatatgcaaaccgttcgtc
gagaaacacatagcgcttatcgcaccaagtatcttggtgctggtaggcagcactgcatgt
tgctctctgctaagcacacccgaaagtatatccagattgcgggggaggtttcacgaatat
gctaaccctttccttgcgcatcccataaaaaccgctgtaatcttccacccagcatattta
ctgcgccaacctatgcagaaacggctcgcttgggaggatttgaagatgatcaggtctcac
attgagaatgagaaaataacagtagacgcctag

DBGET integrated database retrieval system