KEGG   Amycolatopsis methanolica: AMETH_0282Help
Entry
AMETH_0282        CDS       T03230                                 

Gene name
lig
Definition
(GenBank) DNA ligase, ATP-dependent
Organism
amq  Amycolatopsis methanolica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIJ20374
UniProt: A0A076MI15
LinkDB All DBs
Position
complement(289834..290547)
Genome map
AA seq 237 aa AA seqDB search
MVATLTQQPFSRENWLFERKLDGVRTICSRDGGRPVLWSRNHNDISAGYPELGEALAGSG
ASSFVADGEIVAFDGNQTSFARLQQRIHLADRRRIEATGVAVHLYLFDLLAFDGHDTTGL
PLRQRKQLLRKAFDWGGVLRYATHRNTTGEEYSAHACARGWEGVIAKRADAPYRSGRTTD
WLKFKCVKEQEFVVGGFSAPGGARTGFGALLVGYYDRGRLRYAGKVGAATASPRCVS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgacgctgacccagcagccgttttccagggagaactggctgttcgagcgcaag
ctggacggggttcgcaccatctgctcgcgcgacggcggccggcccgtgctgtggtcgcgc
aaccacaacgacatcagcgccggatacccggaactcggggaggcgctcgccggatcgggc
gcctcctccttcgtcgccgacggcgagatcgtcgccttcgacggcaaccagaccagcttc
gcccggctgcagcaacgcatccacctggccgaccggcggcgcatcgaggccaccggggtc
gcggtgcacctgtacctgttcgacctgctggccttcgacggccacgacacgaccgggttg
ccgctgcggcaacggaaacagttgctgcgcaaggctttcgactggggcggggtgttacgg
tacgccacgcaccgcaacaccaccggcgaggagtactccgcccacgcgtgcgcgcgcggc
tgggagggcgtgatcgcgaagcgggcggacgcgccgtaccggtccgggcggacgaccgac
tggctgaagttcaagtgcgtcaaggaacaggagttcgtcgtcggcgggttcagcgcgccg
ggtggggcgcggaccgggttcggcgcgttgctggtcggctactacgaccgcggccggttg
cggtacgcgggcaaggtcggcgccgctacagcgagtccacgctgcgtgagctga

DBGET integrated database retrieval system