KEGG   Amycolatopsis methanolica: AMETH_0794Help
Entry
AMETH_0794        CDS       T03230                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00020  Citrate cycle (TCA cycle)
amq00480  Glutathione metabolism
amq01100  Metabolic pathways
amq01110  Biosynthesis of secondary metabolites
amq01120  Microbial metabolism in diverse environments
amq01130  Biosynthesis of antibiotics
amq01200  Carbon metabolism
amq01210  2-Oxocarboxylic acid metabolism
amq01230  Biosynthesis of amino acids
Module
amq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMETH_0794 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMETH_0794 (icd)
Enzymes [BR:amq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AMETH_0794 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AIJ20886
UniProt: A0A076MPI8
LinkDB All DBs
Position
802175..803398
Genome map
AA seq 407 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWKFIKDKLIHPYLDINLEYYDLGIEERDRTDDQITVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIIQNIPRL
VPGWTKPIIIGRHAHGDQYKATDFKVPGPGTVTMTYVPEDGSEPIEFEVARYPEGGGVAM
GMYNYRKSIEDFARASLQYGLDRGMPVYMSTKNTILKAYDGMFKDTFQEIFETEFKADFD
AKGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDGNSELVGFANKLE
QVVIETVESGKMTKDLALLVGKDQPFQTTEEFLATLDENLAAKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtcgagggcaccgtcgtagaactcgacggcgacgagatgactcgc
atcatctggaagttcatcaaggacaagctgatccacccgtacctcgacatcaacctcgag
tactacgacctgggtatcgaagagcgcgaccggaccgacgaccagatcaccgtcgactcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgccaccatcacgccggacgag
gcccgggtcgaggagttcggcctgaagaagatgtggcggagcccgaacgggaccatccgc
aacatcctcggtggtgtcgtcttccgtgagccgatcatcatccagaacatcccgcggctg
gtcccgggctggacgaagccgatcatcatcggccgtcacgcgcacggtgaccagtacaag
gcgaccgacttcaaggttcccggccccggcacggtgaccatgacgtacgtgcccgaggac
ggctccgagccgatcgagttcgaggtcgcccgctacccggagggtggcggcgtcgcgatg
ggcatgtacaactaccgcaagtcgatcgaggacttcgcgcgcgcctcgctgcagtacggc
ctggaccgcggcatgccggtctacatgtcgacgaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacaccttccaggagatcttcgagaccgagttcaaggccgacttcgac
gccaagggtctgacctacgagcaccgcctgatcgacgacatggtcgccgcttcgctgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggttcgctgggcctgatgacctcggtgctgcgcacgccggacggc
aagaccgtggaagccgaggccgcgcacggcacggtcacccggcactaccggcagcaccag
cagggcaagccgacctcgacgaacccgatcgcgtcgatcttcgcgtggacccggggtctc
gagcaccgcggcaagctggacggcaactccgagctggtcggcttcgccaacaagctcgag
caggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctggcgctgctcgtc
ggcaaggaccagccgttccagacgacggaggagttcctggcgaccctggacgagaacctg
gcggcgaagatcgcccagggctga

DBGET integrated database retrieval system