KEGG   Amycolatopsis methanolica: AMETH_1315Help
Entry
AMETH_1315        CDS       T03230                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
amq  Amycolatopsis methanolica
Pathway
amq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:amq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AMETH_1315 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amq03400]
    AMETH_1315 (lig)
Enzymes [BR:amq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMETH_1315 (lig)
DNA repair and recombination proteins [BR:amq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AMETH_1315 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIJ21407
UniProt: A0A076MU87
LinkDB All DBs
Position
1355067..1355996
Genome map
AA seq 309 aa AA seqDB search
MAEDRVTVQVDGRRLSLSNLDKVLYPEAGFTKGQVIDYYARVAPVILPHLRDRALTFRRW
PGGVQSNPFYEKDAGRHAPDWVKTAKIASGGRGQSSDVNAYPLVNDVPTLIWAANLAALE
LHAPQWTVGPRGARRNPDLLVFDLDPGEPATIVECCRVAERLRDLLAADGLRLYPKTSGS
KGLQLYAAVKTATPEDTSAYAKAAAKKLAAETPGEVTAAMTKSLRPGKVFIDWSQNNPHK
TTVAPYSLRGRPEPTVSTPVTWDEVEACRRPAQLKFLSDDVLDRVEEIGDLFEDLHDDPV
KLPRARAGQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacagggtgacggtgcaggtcgacgggcgccgtctgtcgttgtccaacctg
gacaaggtgctctaccccgaagccgggttcaccaaggggcaggtgatcgactactacgcg
cgcgtcgccccggtcatcctgccgcacctgcgggaccgggcgctcaccttccgccgctgg
ccgggcggggtccagtcgaatccgttctacgagaaggacgccggacgccacgcccccgac
tgggtgaagaccgcgaagatcgcgagcggcgggcgcggtcagagctcggacgtgaacgcg
tatccgctggtcaacgacgtgccgacgttgatatgggcggccaacctcgccgcgctggaa
ctgcacgcgccgcagtggaccgtcggcccgcgcggggcccgccgcaaccccgatctgctg
gtgttcgacctcgacccgggcgagccggcgacgatcgtcgagtgctgtcgcgtcgccgag
cggctgcgcgacctgctggcggccgacgggctgcggctctacccgaagaccagcggctcg
aagggcctgcagctgtacgcggcggtgaagaccgcgaccccggaggacacctcggcctac
gccaaggccgccgcgaagaagctcgccgccgagacgccgggagaggtcaccgcggcgatg
accaagagcctccggcccggcaaggtgttcatcgactggagccagaacaacccgcacaag
acgacggtcgcgccgtactcgctgcgcgggcgcccggagccgaccgtgtccacaccggtc
acctgggacgaggtggaggcgtgtcgccgccccgcgcagttgaagttcctcagcgacgac
gtcctcgaccgggtggaggaaatcggcgacctgttcgaggacctgcacgacgacccggtc
aaactgccccgggcgcgcgccggacagtaa

DBGET integrated database retrieval system