KEGG   Amycolatopsis methanolica: AMETH_3739Help
Entry
AMETH_3739        CDS       T03230                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00564  Glycerophospholipid metabolism
amq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMETH_3739 (glpA)
Enzymes [BR:amq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMETH_3739 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA Pyr_redox NAD_binding_8 3HCDH_N Thi4 Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIJ23831
UniProt: A0A076MXX4
LinkDB All DBs
Position
3852571..3854256
Genome map
AA seq 561 aa AA seqDB search
MSQPLSPAYRGDALRRLANEEFDVLVVGGGVTGAGAALDAASRGLSVALVEARDLAAGTS
SRSSKLIHGGLRYLEQLDFKLVREALRERGLLLRTLAPHLVRPVKFLVPLQHRVWERGYI
GAGVTLYDTLGGARALPRHRHLSRRRAFEVAPGLADDALIGAIQYYDAQVDDARHTMMIA
RTAADQGAAVVTRTRVTSLVRDGERVVGARVTDRESGAEITVRARVVIAATGVWSDDIAE
AAGIEKPFTVRASKGIHLVVPREKIDLDTGLILRTEKSVLFVIPWGPHWIVGTTDTEWDL
DREHPAASRADVDYVLDHVNGVLRKPLTHDDIEGVYAGLRPLLAAKATATTKLSREHAVA
HPVPGLVVVAGGKYTTYRVMAADAVDAAMSDVDRPAPPSWTDKLPIVGARGYAEVWEGRY
ALARRAGLPVARIEHLLGRYGTAVEEVLALVGERPELGEEIPGAPDYLKAEAVYAVTHEG
ALHLEDVLTRRTRISIEQRDRGLAAAPAVADLIAPELGWTAERRDREVAHYRARVEAERT
AQEAPDDATANERRLAVPALG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccaacccctgtcccccgcataccgcggcgacgcgctgcggcggctggcgaacgaa
gagttcgacgtgctcgtcgtcggtggcggcgtgaccggcgcgggcgccgcgctggacgcg
gcctcgcgcgggctgtcggtcgccctggtcgaggcccgcgacctggccgcgggcacgtcc
agccggtcgagcaagctgatccacggcggcctgcgttacctggagcagctggacttcaag
ctggtgcgggaagcgctgcgtgaacgcgggctgctgctgcgcaccctcgcgccgcacctg
gtgcggccggtgaagttcctggtgccgctccagcaccgggtctgggagcgcggctacatc
ggggccggggtcacgttgtacgacacgctcggcggggcgcgggcgctgccgcggcaccgg
cacctgagccggcggcgcgcgttcgaggtggcgcccggcctcgccgacgacgcgctgatc
ggcgcgatccagtactacgacgcgcaggtcgacgacgcgcggcacacgatgatgatcgcg
cgcacggcggccgatcagggcgcggcggtggtcaccaggacgcgggtgacctcgctggtc
cgcgacggcgagcgggtcgtgggcgcgcgggtcaccgaccgggagagcggcgcggagatc
acggtgcgggcgcgggtggtgatcgccgcgaccggggtgtggagcgacgacatcgccgag
gccgccggcatcgagaagccgttcacggtgcgcgcgtcgaagggcatccacctggtggtg
ccgcgggagaagatcgacctggacaccgggctgatcctgcgcaccgagaagagcgtgctg
ttcgtgatcccgtggggcccgcactggatcgtcggcaccacggacaccgagtgggacctg
gaccgcgagcacccggctgccagccgcgcggacgtggactacgtgctcgaccacgtgaac
ggggtgctgcgcaagccgttgacgcacgacgacatcgagggcgtgtacgccgggttgcgg
ccgttgctggcggcgaaggctaccgcgacgacgaagctgtcgcgggagcacgcggtggcg
cacccggtgccggggctggtggtcgtggccggcgggaagtacacgacgtaccgggtgatg
gcggcggacgcggtggacgcggcgatgtccgatgtggaccgtccggcgccgccgtcgtgg
acagacaagctgccgatcgtgggcgcgcgcgggtacgcggaggtctgggagggccggtac
gcgctcgcgcggcgcgcgggactgccggtggcgcggatcgagcacctgctgggccggtac
ggcacggcggtcgaggaggtcctggcgctggtcggtgagcggccggagctgggcgaggag
atccccggggcgccggactacctgaaggccgaggccgtgtacgccgtgacgcacgaaggc
gcgctgcacctggaggacgtgctgacgcggcggacgcggatctcgatcgagcagcgggac
cgcggactggcggcggcgcccgcggtggccgacctgatcgccccggagctgggctggacc
gccgagcgccgcgaccgcgaggtggcgcactaccgggcccgcgtcgaggcggaacgcacc
gcccaggaagcccccgacgacgcgacggcgaacgaacgccgcctggcggtgccggcgctg
gggtga

DBGET integrated database retrieval system