KEGG   Amycolatopsis methanolica: AMETH_4643Help
Entry
AMETH_4643        CDS       T03230                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
amq  Amycolatopsis methanolica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF742
Motif
Other DBs
NCBI-ProteinID: AIJ24735
UniProt: A0A076N1Q3
LinkDB All DBs
Position
complement(4782544..4784043)
Genome map
AA seq 499 aa AA seqDB search
MTTKTTSVPISKPGQFYIDGQWVDPSTTHTIEVIEAATEELFFTVAAAEAADVARAVGAA
RRAFDDGPWPRMPPSRRAEFLRAIAQAAAQRCDDLVQLWPRETGVIARIAPAVLEEVPAA
FNYYADLADRYPFEQEVPTSSGEGFGMIVAEPVGVVGAIIPWNTPMHLAAWKLAPALLAG
CTVIVKASPEAPGAAYVIAEIAEQVGLPPGVVNVLTADREASEALVTDHRVDKITFTGST
AVGKRIAGLMAERIGRYTLELGGKSAAVVLDDMDIAEAADSLTGGACFVSGQICASLTRI
IVPRHRHDEMVEALAERFARVKVGDPFDPSVQMGPLASRRQRERVEDYVRIGKDEGATLA
FGGNRPKDLDRGWFIEPTVFGNVDNSSRIAQEEIFGPVISVIAAADEEDAIRIANDSVFG
LNASVFTHDADRAREVARCLRAGTVGQNGNRADFGIGFGGFKQSGVGREGGVAGLLPYLE
NKTVVLDQKPRFSSSEGQR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaagacgaccagcgtgccgatctcgaaaccggggcagttctacattgacggg
cagtgggtcgatccctcgacgactcacacgatcgaggtgatcgaagcggcgacggaggag
ttgttcttcactgtcgccgcggccgaagcggcggatgtcgcgagggcggtgggagcggcg
cggcgtgccttcgacgacggcccgtggccacgaatgccgccgagccggcgggcggagttc
ctgcgcgccatcgctcaggctgcagcccagcgctgcgatgacctggtccagttgtggccc
cgtgagacgggggtcatcgcccgtatagcgccggccgtcctggaggaggtcccggcggcg
ttcaactactacgctgatctcgccgatcggtatccgttcgagcaggaggtgccgaccagc
tcaggcgaaggcttcgggatgatcgtcgccgagcccgtaggcgtcgtgggggcgatcatt
ccgtggaacactccgatgcacctggccgcctggaaactggcgcccgcgctgctcgccggg
tgcacggtgatcgtcaaggcgtcaccggaggcgccgggcgctgcgtatgtcatcgcggag
atcgctgaacaggttggcctccctcccggtgtggtgaacgtgctcacggccgacagggag
gcctctgaagcgttggtgaccgatcaccgcgtggacaagatcaccttcaccgggtccaca
gcggtcgggaagaggatcgccgggctcatggcggagcgcatcgggcggtacaccctcgag
ctgggaggcaaatcggcggcggtcgtcctcgacgacatggacatcgccgaggcggccgac
agcctgaccgggggcgcgtgctttgtctccggccagatctgtgcgtccctcacccggatt
atcgtgcctcgccatcggcacgacgagatggtcgaggcgctcgccgagcgcttcgcccgg
gtcaaggtgggggacccgttcgaccccagcgttcagatgggaccgctggcctctcggcga
cagcgcgagcgggttgaggactacgtccggatcggcaaggacgaaggggctaccctggcg
ttcggtggtaaccgccccaaggacctcgaccggggctggttcatcgagccgactgtcttc
gggaatgtggacaactcctcccgcatcgcccaagaggagatcttcgggccggtgatctcc
gtcatcgccgctgctgacgaggaagacgcgatccggatcgccaacgattccgtgttcggt
ctcaatgcttcggtgttcacacacgacgcggaccgtgctcgcgaggtggccaggtgcctg
cgcgcaggaacagtggggcagaacggaaaccgggcggacttcgggatcggcttcggtggc
ttcaagcagtctggtgtcggccgagagggcggcgtcgccggtcttctgccgtacctcgaa
aacaagaccgtagtgctcgatcagaagccgcggttctcctcgtccgaagggcagcgctga

DBGET integrated database retrieval system