KEGG   Amycolatopsis methanolica: AMETH_5649Help
Entry
AMETH_5649        CDS       T03230                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00380  Tryptophan metabolism
amq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AMETH_5649
Enzymes [BR:amq01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AMETH_5649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIJ25741
UniProt: A0A076N3G3
LinkDB All DBs
Position
complement(5818004..5819170)
Genome map
AA seq 388 aa AA seqDB search
MSLRDEAAELDARDPLAGKRAEFDLDPDVSYLDGNSLGAPPRGVAPRLAEVVGEQWAGRL
IRSWDEGWWDAPERIGDRIAPLIGAGPGQVVVGDSTTVNLFKAGVAAARLNPGRPEILVD
AGTFPTDGYIAESAARMTGHSVRRVPVGALASEVGPRTAVVLVNHVDYVTGELHDMPGIT
AAVHAAGAVVVWDLCHSVGAVPVPLDAAGVDLAVGCTYKFLNGGPGAPAFLYVARKWLDE
FDQPLTGWAGHADPFGMTPAYAGRAGISRGRTGTPDILSMLALDAALDVWRDVTIDQVRA
KGLALGDFFLRCLDSLVPGARVVTPRSHARGNQVSVAWPDAKAAMGKLIARGVIGDFRPP
EVLRFGLAGLYVRYADVLRAAEELRGLR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcgagacgaagcggccgaactcgacgcgcgggacccgctggcgggcaagcgg
gcggagttcgatctcgacccggacgtgtcctatctggacggaaattcactgggcgccccg
ccgcgcggggtcgcgccgcggctcgcggaggtcgtcggcgagcagtgggccgggcggctg
atccggtcctgggacgagggctggtgggacgcgccggagcggatcggcgaccgcatcgca
ccgttgatcggggcggggccgggccaggtggtggtcggtgactcgacgacggtgaacctg
ttcaaggcgggggtcgcggcggcgcggttgaacccggggcggccggagatcctggtcgac
gcgggcacgttccccacggacggctacatcgctgagagcgcggcgcgcatgaccggtcac
tcggtgcggcgggtgccggtcggggcgctggcgtcggaggtcggtcctcggacggccgtg
gtgctggtcaaccacgtcgactacgtgacgggggagctgcacgatatgccgggcatcacg
gcggcggtgcacgcggccggggcggtcgtggtgtgggacctgtgtcattcggtgggggcc
gtgccggtgccgctggacgctgccggggtcgacctggcggtggggtgcacgtacaagttc
ctcaacggcgggcccggggcgccggctttcctctatgtggcgcggaagtggctcgacgag
ttcgaccagccgctgaccggctgggccgggcatgcggatccgttcgggatgactccggcc
tatgccgggcgggcgggcatcagccgcggccgcaccggaacgccggacatcctgtcgatg
ctggcgctggacgccgcgctggacgtgtggcgcgacgtgacgatcgaccaggtccgagcg
aaggggctcgcgctgggggacttcttcctgcggtgcctggactcgctggtgccgggcgcg
cgcgtggtgacgccgcggtcgcacgcgcgggggaaccaggtgtcggtcgcgtggccggac
gccaaggcggcgatggggaagctgatcgcgcgcggggtcatcggggacttccggccgccc
gaggtgctgcgattcgggctggccgggttgtacgtgcggtacgcggacgtgctgcgggct
gccgaggagttgcgtgggttgcggtag

DBGET integrated database retrieval system