KEGG   Amycolatopsis methanolica: AMETH_6653Help
Entry
AMETH_6653        CDS       T03230                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00250  Alanine, aspartate and glutamate metabolism
amq00410  beta-Alanine metabolism
amq00430  Taurine and hypotaurine metabolism
amq00650  Butanoate metabolism
amq01100  Metabolic pathways
amq01110  Biosynthesis of secondary metabolites
amq01120  Microbial metabolism in diverse environments
amq02024  Quorum sensing
Module
amq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMETH_6653 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMETH_6653 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMETH_6653 (gadB)
   00430 Taurine and hypotaurine metabolism
    AMETH_6653 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AMETH_6653 (gadB)
Enzymes [BR:amq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AMETH_6653 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIJ26745
UniProt: A0A076N7C1
LinkDB All DBs
Position
complement(6814006..6815397)
Genome map
AA seq 463 aa AA seqDB search
MVLHAGERGADDRPGGSNPLHAVTSPALAATYTPPRSRLNDETLPADTALQVVRDELMLD
GNARLNLATFVTTWMEPQARELIADCADKNMIDKDEYPQTAELERRCVSILADLWHAPDP
AAVMGCSTTGSSEACMLAGMALKRRWSKLGRTGRPNLVMGANVQVCWEKFCEYWEVEPRL
VPMDGDRFHLTAEEAVARCDENTIGVVAILGSTFDGSYEPVAGIAAALDRLQSERGWDIP
VHVDGASGAMIAPFLDADLEWDFRLRRVASINTSGHKYGLVYPGVGWVLWRDRDALPSEL
VFNVNYLGGDMPTFALNFSRPGAQVVAQYYNFVRLGREGFRIVQQACRDVATRLAGRIAE
LGPFELLTRGDQLPVFAFTTRDDVTGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRI
VCRNGFTHDLADLLVEDLKRVLPELAEQDRPQHKPATSTAFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacgcgggtgaacggggagccgacgaccggccgggcgggagcaacccgctg
cacgcggtgacgagtccggcgctggcggcgacctacacgccgccccgcagccgtctgaac
gacgagaccctgcccgccgacaccgcgctccaggtggtgcgggacgagctgatgctcgac
gggaacgcgcggctcaacctggcgacgttcgtcaccacctggatggagccgcaggcgcgc
gagctgatcgccgactgcgccgacaagaacatgatcgacaaggacgagtacccgcagacc
gcggagctcgagcggcgctgcgtgagcatcctggccgacctgtggcacgcgccggacccg
gcggcggtcatgggctgctccacgaccggctcgtccgaggcgtgcatgcttgccgggatg
gcgctcaagcggcgctggagcaagctgggccggaccggcaggccgaacctcgtgatgggc
gcgaacgtccaggtctgctgggagaagttctgcgagtactgggaggtcgagccgcggctg
gtgccgatggacggcgaccgcttccacctcaccgcggaggaggccgtcgcgcgctgcgac
gagaacacgatcggcgtggtcgcgatcctcggctccaccttcgacggcagctacgagccg
gtcgcggggatcgccgccgcgctggaccggttgcagtccgagcgcggctgggacatcccg
gtgcacgtcgacggcgcgtccggggcgatgatcgcgccgttcctcgacgccgacctggag
tgggacttccgcctgcgcagggtggcctcgatcaacacctcggggcacaagtacgggctg
gtctacccgggcgtcggctgggtgctgtggcgggaccgcgacgcgctgccgtccgagctg
gtgttcaacgtgaactacctgggtggcgacatgcccacgttcgcgctcaacttctcccgt
ccgggcgcccaggtggtggcgcagtactacaacttcgtccggctgggccgtgaggggttc
cggatcgtgcagcaggcctgccgcgacgtcgcgacccggctggccgggcggatcgccgag
ctcgggccgttcgagctgctcactcgcggcgaccagctgccggtgttcgcgttcaccacc
cgtgacgacgtgaccggcttcgacgtgttcgacgtgtcccggcggctccgggaacgcggc
tggctcgtgcccgcctacacgttcccggagaaccgcaccgacctcgccgtgctgcggatc
gtgtgccgcaacggcttcacgcacgacctggccgacctgctggtcgaggacctgaagcgg
gtcctgcccgaactcgccgagcaggaccgtccccagcacaagcccgcgaccagcacggcc
ttccaccactag

DBGET integrated database retrieval system