KEGG   Acaryochloris marina: AM1_1839Help
Entry
AM1_1839          CDS       T00617                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
amr  Acaryochloris marina
Pathway
amr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01130  Biosynthesis of antibiotics
amr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AM1_1839
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     AM1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: ABW26859
UniProt: B0CDD4
LinkDB All DBs
Position
complement(1828207..1829091)
Genome map
AA seq 294 aa AA seqDB search
MSLSIAHLGPAGTYAEQAAIAYADWYANLTQQPIPILCPCPSIAQALQSTAAGDTKLSVS
PVENSIEGSVSVTLDTVWQLEMLQIRQALVLSIEHVLIAKAQQLQSIQAVYSHPQALGQC
QTWLKHNLPQATLVPASSTTEALNYVDEDGSIAAISSERAAQLYQLPVIQRSIQDHPDNC
TRFWIVSQKETPYPVTAPEGSPVYTSLAFSLPANVPGALLQPLKIFNDRHINLSRIESRP
SKRSLGEYVFFVDAEADLNTSFFQSALDELTSHTEVLKVFGSYPLVQVVGTVGP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttccattgcccacctggggcctgcaggaacctatgcagaacaagctgcgatc
gcatatgcggattggtacgctaatcttacgcaacagccgatccccatcctctgtccctgt
cccagcattgcccaagcgctgcaatcgaccgctgctggcgatactaaactttctgtttcc
ccagtcgagaactccattgaaggcagtgtctccgttaccttagataccgtctggcagctg
gaaatgctgcaaattcggcaagctttagtgttatccattgagcatgtcttgattgccaaa
gcgcaacaattgcagtcgattcaagcggtctattctcacccgcaagccctcggacaatgc
cagacctggctgaaacataacttaccccaagcgaccttggtgcctgccagctcaacgaca
gaggcccttaattatgtggatgaggacggttcaattgcagcgatctcctcagaacgagcg
gctcagctgtaccaactgccggtgattcagcggtccatccaagatcatcccgataactgc
acccgattttggattgtgagccaaaaagagacaccttatcccgttacggctccagagggt
agcccggtatatacatctttagcctttagcttgccagcaaatgttcccggtgcgttgttg
cagcccctaaagattttcaatgaccgacatattaatctcagtcggattgagtctcgtccc
agcaaacgctccttaggagaatatgtcttttttgtggatgcagaggcggacttaaatacc
agcttttttcaatctgctttagatgagttaacctctcacactgaagtgctgaaagtattt
ggcagttatcccctggtgcaagtggtggggaccgttgggccatag

DBGET integrated database retrieval system