KEGG   Acaryochloris marina: AM1_3571
Entry
AM1_3571          CDS       T00617                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00020  Citrate cycle (TCA cycle)
amr00620  Pyruvate metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01200  Carbon metabolism
Module
amr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_3571
   00020 Citrate cycle (TCA cycle)
    AM1_3571
   00620 Pyruvate metabolism
    AM1_3571
Enzymes [BR:amr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AM1_3571
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: ABW28561
UniProt: B0C2A9
LinkDB
Position
3620224..3621564
AA seq 446 aa
MIHEVFMPALSSTMEEGKIVSWSKEPGDKVEKGETVLVVESDKADMDVESFHEGYLAAIA
VPAGGVAKVGAAIGYVAETEAEIAEAQKKASAAESAAPAPAAPAPAPAAPAPAAVAPAPP
AAAPAPVATIPVAPAATLNGGSAPAAPSNGRVVVSPRARKLAKQFKVDLNTLTGSGPHGR
IVAADIEAASGQTSTTATAPAASSAAPQPSLPASAPLPAGAAAGEVVPFNTLQQAVVNNM
VASLAVPTFHVEYSIVTDALDQLYKQVKTKGVTMTALLAKAVAVTLRQHPLVNASCAPQG
IQYSSAINIAVAVAMPGGGLITPVLQQADQMDLYSLSRTWRDLVARARSKQLQPDEYSTG
TFTLSNLGMFGVNSFDAILPPGQGSILAIGGSKPQVVADDQGMMGVKRLMNVNITCDHRV
IYGADAAAFLKDLAELIETNPQSLTL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgattcatgaagtgtttatgcctgccctcagctccacgatggaggagggaaaaattgtc
tcttggtctaaggagccaggtgacaaggtcgaaaagggtgaaacggttctggtggttgaa
tccgacaaggcagatatggatgtggagtccttccatgagggatatctagcagccatcgcg
gtgcctgcgggtggggtggccaaggtcggtgcggccattggctatgttgccgaaacggaa
gctgaaattgctgaagcacaaaagaaagcatctgccgctgagtctgcggcccctgcacct
gcagctccggcccctgcacctgcagctccagcccctgctgcagtagctccggctcctccg
gctgcggccccggcccctgttgctactattccagtagccccagcagctaccttaaatgga
ggcagtgcaccggctgctccatctaacggtcgagtggtggtttcacctcgggcgcggaag
cttgctaagcaattcaaagtcgatctcaataccctaacgggcagtggtccccatggtcga
atcgtggctgcagatatagaagcagcctctggccaaacgtcgaccactgctacggctcca
gccgccagcagtgctgcgcctcagccatccctacctgcctccgctcccttacccgctgga
gcagcagccggtgaagtagttcccttcaataccttgcagcaggctgtggtgaacaacatg
gtggctagtctagctgtgcccaccttccatgtggaatattccattgttacagatgccctg
gaccagctgtataagcaagtcaagaccaaaggtgtcactatgacggccctcttggccaaa
gctgtggcggttaccctgcgccagcatcccctggtcaatgccagctgtgccccacaagga
atccagtacagcagcgccatcaatattgctgtggcggttgccatgcctgggggcggtttg
attacgccagttctgcaacaggcggatcagatggatttatattccctctctcgcacttgg
agagatttagttgctcgcgcccgtagcaaacagctgcagccggatgaatacagtaccggc
acctttaccctttccaatctgggaatgtttggggtcaacagctttgatgccattctgccc
ccagggcaagggtccattctggcgattggtgggtctaagccccaagtcgtggcggatgat
cagggcatgatgggggtgaagcgactgatgaatgtcaacattacctgcgatcaccgggtg
atctatggtgccgatgccgctgcctttttgaaggatttagcggagttgattgaaaccaat
ccccaatccttgaccctgtaa

DBGET integrated database retrieval system