KEGG   Acaryochloris marina: AM1_3645Help
Entry
AM1_3645          CDS       T00617                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Choline_kinase Fructosamin_kin DZR zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ABW28635
UniProt: B0C3D6
LinkDB All DBs
Position
complement(3700648..3702288)
Genome map
AA seq 546 aa AA seqDB search
MIACLNPACNHSNSESATVCEQCQTSLRLCDRYRPTKLLGQGGFGRTFLAVDEGEANHPA
CVIKQVWPAQFPDPDKIVALFHQEAQLLQELGQHPQIPQLFTSFEQDDALYLVQEYIAGH
NLAQERAEVDRFSPLHVQQLLAELLPVLSFIHQHQLLHRDIKPANIIRRTTDQQLVLVDF
GAAKRLTGTAIAKTGTSIGSAEYIAPEQARGKAKFASDLYSLGVTCIHLLTGLSPFDLMD
GDGVWIWESLYDQTIEPSLVTVLNQMIAPALSQRYGRVEDAIVDLYTPGKLKQPSHNRLL
LGAGLLGSLVLGGFLYQLFPQTSSSPSGSVVINTPKPAPQNPPQAPVPKSPSPTIPIPTP
ATSTELKAMENLIFIANASGQYYQAHGQFLTDLSRQPSLDQYTLQITKLGQHGLQVSGIP
TTEKLRSFIILAWGGPSPASSSKPTSAETQPNSNPQDDLSLFQLPNLNRSGKAAPNIVVT
NYCESLKPSQKRPPKADLPTRQPKTYQDWTCPEGYTFAFTALEVISKLASTQSPSVLFQV
PPSASN
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttgtttaaatccagcttgtaatcacagcaattctgagtctgcaacggtttgt
gagcagtgccaaacatcgttacgcttgtgcgatcgctaccgccccacgaaactcctcggt
caaggcggatttggccgtaccttcctcgctgttgatgaaggtgaagccaatcatcccgcc
tgcgtcatcaaacaggtttggcccgcccaattcccagatccagacaagattgttgcgctc
tttcaccaggaagcccaactgttacaagaactgggacagcatccccaaattcctcaactg
ttcacgtcttttgagcaggatgatgccctttatttagttcaggaatatatcgcaggccac
aacttggctcaggaaagagcagaagtcgatcgattcagcccgctacacgttcaacagcta
ctggctgaactcttgccagtcttgagctttatccatcagcatcagttgctccatcgtgat
atcaaacccgccaatatcattcgacgaaccactgaccagcagctcgtcctcgtcgatttt
ggggcagccaaacggctaacgggcaccgccatcgctaaaacgggcaccagcatcggtagc
gctgaatatatcgcccccgaacaggctcgggggaaagctaagtttgccagcgacctgtat
agcttaggggtgacgtgcatccatctcctcacagggctatctccttttgatctgatggat
ggtgatggcgtctggatttgggaatcgctctatgaccagacgattgagccatcgttggtg
accgtcttgaatcagatgattgccccagccctaagtcaaagatatggacgtgtagaagat
gcgatcgtagacctctacacccctggaaaactcaaacagcctagccacaatcggctactc
ttgggtgctggccttctaggcagcctagtattagggggctttctatatcagttattccct
caaacctcatcttcgccctctggttctgtcgtcataaatacaccaaaacctgccccacag
aatcccccacaagcaccagtccccaaatctccatcaccaacaatacccatacctacacct
gctacaagcaccgaattaaaagcgatggaaaacctaatttttatcgccaatgccagcggc
caatactatcaggcccatggacaatttttaactgacttatctcgccagccttccctagat
caatacacactccaaattacaaaactaggccaacatggccttcaagtgtctggtatacca
acgacagaaaagcttcggagttttatcattctggcttggggtgggccttctcccgcttcc
tctagcaaacctacttctgcagaaacacagcccaacagcaatcctcaggatgacttgagt
ttatttcaactccctaatctaaatcgaagcgggaaagcggcaccgaacatcgtggtcacg
aactattgcgagagcttaaaacccagtcagaagagacccccaaaagctgatttaccaaca
cgacaacccaaaacttaccaagattggacttgtcctgaaggctatacctttgccttcacg
gctttagaagtcatcagcaagttagcatcaacccaaagtcctagcgtcctttttcaagtc
ccaccctctgcatctaattag

DBGET integrated database retrieval system