KEGG   Acaryochloris marina: AM1_3669Help
Entry
AM1_3669          CDS       T00617                                 

Definition
(GenBank) superoxide dismutase Mn/Fe domain protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
amr  Acaryochloris marina
Brite
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AM1_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: ABW28659
UniProt: B0C3G0
LinkDB All DBs
Position
complement(3724913..3725512)
Genome map
AA seq 199 aa AA seqDB search
MVYQLPDLPYDYNALEPHISARTLEFHHDKHHAAYVTKCNGMTKDTPMDDMSIEEVIQSA
YKDSAKAGLFNNAAQAWNHSFYWNSMKPGGGGLPGGALAAQINTDFGNYDNFKAAFKEAG
ATQFGSGWAWLVLENGKLKITKTPNAENPLVHGQTPLLTMDVWEHAYYLDFQNSRPGYID
TFLSSLVNWDFAAQNFGAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtttaccaactacctgacctgccgtacgattacaacgctttagagcctcatatttcc
gcccgaaccctagagttccaccatgacaaacaccatgcagcatatgtgaccaagtgtaat
ggcatgaccaaggatactccgatggatgacatgtccattgaggaagtcattcagtctgcc
tacaaggattctgccaaagccggtctctttaacaatgcagcccaagcttggaaccacagc
ttttattggaactccatgaagcccggcggcggtggtctgcccggtggtgcattagcggcc
caaatcaatacggattttggcaactacgataactttaaggctgcttttaaggaagctggc
gccactcagtttggcagtggctgggcttggctcgtcttggagaatggcaagctaaaaatc
accaaaacacccaatgctgaaaatccgttggtccatgggcaaacccctttgctgacgatg
gatgtttgggagcatgcctattatctagatttccaaaacagccgtcctggctatattgac
acctttttatctagcttggtcaactgggactttgccgcccaaaactttggagccgcctaa

DBGET integrated database retrieval system