KEGG   Acaryochloris marina: AM1_3746Help
Entry
AM1_3746          CDS       T00617                                 

Definition
(GenBank) conserved hypothetical protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAS BRCT CENP-F_leu_zip Spc7 APG6_N PTCB-BRCT Phage_GP20 FlxA KELK ATG16 TMF_TATA_bd BRCT_2
Motif
Other DBs
NCBI-ProteinID: ABW28736
UniProt: B0C5L5
LinkDB All DBs
Position
3803017..3806580
Genome map
AA seq 1187 aa AA seqDB search
MPELSSILDLRLVLESVGALLLGTATVDTLRQRQWQQQLTSASEEQQRLLTADQARLQTE
QQTLQTDNETLTAALAKAKQVVEAQEQSVEELKQQVSQLQQQQRAWADEKQAQDQQQKTL
ETELDTQKAQCQQLQAELDERAATTTELDNLAAAKTQAEVDLRQAQSKMRGLQLQVDTLT
QAQQPLQAKVTAAEQTAAVATQAKTQLEQQLAQLTQTQQQDQSQVTQAQATIQSLEQQVA
SLTATQKTLENQLQQQSQRDRQRQNLATEVAILQDQIATLTTQNQSLEDDRVAVQQEKDS
LTQRLETLTATHDQLATTQAETVQQLAATTQTHLQLEQAHAQLTAELEGLHHAQTDLSTL
RQEKQTLESLVTEQKQEIDDLTGRLATAKDLQRQLAEDYETAQTSLSALETQDTDFNTEL
AADLQDAHAQIKTLQQNLETLTQQNQDLRNQIAAAPPEQSQALQELEQALQAAQSRNQQQ
QQQLQDLAQEKESLATSLQTAQSNSTELQQQIASLTQQHQELETSLEQTQTADSSLITEL
TTNQQQLTTELTDAQELITNLRQQISDLETAQEAQPTSTDIEALTQTNQTLSAELSDSQT
ALATLRQQLQTLEQQQQRLETEQGAVANDQSKTIAALEAQLQTLQQERETLNQQVAEYQG
HLPSLQEQITDLEQQRQTLESSLQGAEAQAQDLEQQLNTLNQGQTQTQQDLQAQQQQVIT
LEQQVQALEAEKTQLASALKVAEEAPIPLQEALQSAQTEQTQLEQRLTALTQQNQDLQTA
INQASDTSALETELAAVKAEKQQLTVTLQAAEAASLPLQTTLQTAQAEQVRLEQQLAALT
EQNQSLQVSLEQASDTSALEAELAAAKAECDRITQSQQTAETTIQTLTAQLQELESLPEQ
LQSLTQAKAQLEADLQQATTITAEVDQLTQAQQDLQAALSQAEEEKLGLRSQLQTLEQQV
VDLQSATSSVELEQQLQDLTADRDQLQHNYDTATAKITTLQQQLHTLEQQAAELPDLEDA
LPEQMMAAMKEADQQITTLETQVKAMKKDKAELEKAMKMARDVVSHFEQQVENLTQEKQQ
LEQQFQMSTSDDPLATVPAVVPESQPGLPLSGQSFVITGKLAQLSYEQVKTIIQEAGGTI
NTHPSSKTSYVVVGKDPGNKLKKAEKYSIPQLSEQQLMELLGLDLSA
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgtctagtattcttgatcttcgtttggttctagaaagcgttggtgcgctc
ctattggggacagctaccgtcgataccctgcgtcaacggcagtggcagcagcaactcaca
tctgcctctgaagagcaacaacggttgctaacggcggatcaagctcgtctgcagaccgag
caacaaacccttcaaaccgataacgagacgttaaccgcggcccttgccaaggctaaacag
gtggtggaggctcaagaacagagcgttgaagagttaaagcagcaggtcagccagctacaa
cagcagcaacgggcttgggcagacgagaaacaagcccaagatcagcagcagaagacctta
gaaactgaactagatactcaaaaagcgcaatgccaacagctccaggctgaattggatgag
cgggctgctacgactacggagttagacaatctggctgctgcgaaaacgcaagcggaagtg
gatctgcgccaggctcaatccaaaatgcggggtttgcaactccaagtggataccctaacc
caagcacaacagccattgcaggccaaggtaacggcagcagagcagacagccgctgttgct
acccaagctaagacccaactggaacagcagcttgcccagttgactcagacgcaacagcaa
gaccaatcccaggtgacgcaagcccaggcaacgattcaaagtcttgaacaacaagtggcc
agcctgaccgcgacacaaaaaactttagaaaatcagctgcaacagcagtctcaacgggat
cgtcagcgtcagaacttagcgacggaagtggctatactccaagatcaaattgcgaccctc
acgacccaaaaccagagcctagaggatgatcgagtcgctgttcagcaagagaaagatagt
ctaacccagcgattagagaccttaacggccacccatgaccagctagccaccacccaggct
gaaacggttcagcagctggctgctacgactcaaactcatctgcagttggagcaagcccat
gctcagctaacagcagagttagaagggctccatcatgcgcagacggatctctctaccctt
cgccaagaaaaacaaaccctggagtctctggttactgagcaaaaacaggaaattgacgat
ttaacgggacgactggccacggccaaagatctgcaacggcagttggcagaggactatgaa
acagctcagacctccttgtctgctttagagacccaagacacagacttcaacacagagctg
gcggcggatctccaagatgcccatgctcaaatcaagacccttcagcaaaatctggagacc
ctgacccaacaaaatcaagatctgcgtaaccagatcgctgctgctccacctgagcagtcc
caagccttacaggaactcgaacaagccctgcaagctgcccaatccagaaatcaacagcaa
caacaacagctgcaggacctagcccaagagaaagagtcccttgctacttccctgcaaacc
gctcaatccaactccactgagctacagcagcagattgcatccttgactcagcaacaccag
gaattagagaccagtttggagcaaacccaaacggcagattccagtctgattacggaactc
acgactaatcagcagcagctcaccactgaactaactgacgctcaagaactgattaccaac
ctgcgccagcaaatctcagatttggaaaccgctcaagaggctcaacccacaagcacagat
attgaggccctgactcaaaccaatcaaaccctatcggcagagctgtcagactcacaaacc
gccttggcgaccctgcgtcagcaacttcagactctggagcagcaacagcaacgcttagag
acggagcaaggtgcagtcgccaacgaccagtccaaaaccattgctgctttggaagcccaa
ctgcaaaccctgcaacaagaacgggagactctcaatcagcaggtggcggaatatcaaggc
catcttccatctttgcaagagcagattacggatttagaacaacagcgacaaactctggag
tcctcattacaaggtgctgaagcgcaagcgcaggacctggaacagcagctcaataccctg
aatcaagggcaaacccaaactcagcaagatttacaggctcagcagcaacaggtcattacc
ctagaacaacaggtacaggccctggaagcggagaagactcaattagcatctgctctcaaa
gtcgctgaagaagcccctatccctttgcaagaagccttacagtccgctcaaacggaacag
acccagttggagcaacggctgacagcactcacccagcagaatcaggacttacaaactgcg
atcaatcaagcctcggatacttctgcgttggagacagagctggcggcagtgaaggcggag
aagcagcaattaactgtaaccttacaagctgctgaagccgcctcgttgcctttgcaaaca
accttgcaaactgcacaagctgaacaggttcgtttagagcaacagctcgccgcactaaca
gagcagaatcagagcttgcaagtttctctagaacaggcctctgatacctcagctttggag
gcagagttggcggcagcgaaggcagaatgcgatcgcatcacccaatcccaacagacagca
gaaaccaccatccaaaccctgaccgcccaactgcaagagctagagtccctacctgagcag
ctccaatccctgacccaagcgaaagctcagctcgaagccgatctccagcaggccaccacc
ataacggcagaagtggaccagttaacgcaggctcagcaagatttacaggcggcgctatcg
caggctgaggaagagaaactagggttgcgatcacaactccaaaccttagaacagcaggtc
gtggatctgcaatcggcgacgtcatctgtggaactagaacagcagcttcaagatctgacg
gcagatcgcgatcagctgcagcacaactacgacactgcgacggctaaaatcacgacccta
caacagcaactccacaccttagaacagcaggctgctgagctgcctgacttagaggatgcc
ttacctgaacagatgatggcagcaatgaaagaggccgaccaacagatcacgaccctagaa
acccaagtcaaagccatgaaaaaagacaaggcagagttggaaaaagcgatgaaaatggcc
agggacgtcgtctcgcattttgagcaacaggttgaaaacctcacccaagaaaagcaacag
cttgaacaacaattccagatgtctacctcagatgatcctttggccacggtcccagcagtt
gtccctgaatcgcaacctggtctccccctctcgggacaaagttttgttatcactggcaaa
ctggctcagctcagttatgaacaagtgaaaacaatcattcaggaagcaggtggtaccatc
aatacccatcccagttctaaaaccagctatgttgtcgtcgggaaagatccaggcaacaag
ctgaaaaaggctgagaaatatagtatcccgcaattatcagagcagcagttaatggagcta
ttggggttagatctctctgcttga

DBGET integrated database retrieval system