KEGG   Acaryochloris marina: AM1_4560Help
Entry
AM1_4560          CDS       T00617                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amr  Acaryochloris marina
Pathway
amr00620  Pyruvate metabolism
amr00680  Methane metabolism
amr00710  Carbon fixation in photosynthetic organisms
amr01100  Metabolic pathways
amr01120  Microbial metabolism in diverse environments
amr01200  Carbon metabolism
Module
amr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM1_4560 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AM1_4560 (ppc)
   00680 Methane metabolism
    AM1_4560 (ppc)
Enzymes [BR:amr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AM1_4560 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 VPS13
Motif
Other DBs
NCBI-ProteinID: ABW29534
UniProt: B0BZ90
LinkDB All DBs
Position
complement(4592357..4595395)
Genome map
AA seq 1012 aa AA seqDB search
MRSTLNRNHPQLVQPNRLESLLLHRIKVIEDLLEGVLRDECGQELVDLLRQLRSMCSPEG
QAPTVPETEVLKVVEKLELDEAIRAARAFALYFQLINIVEQHYEQEESIVRTRGAITSSP
VALPNVGGSAERAENHANGQTELPEHSIFDAILREPNAGTFTWLFPKLKQLNVPPRHIQN
IIQNLDIQLVFTAHPTEIVRQTIRAKQRRIAKILGKLDEAEAGLANNTRSNWEVDALQAQ
LTEEVRFWWRTDELHQFRPTVLDEVEYSLHYFREVLFDAIPQLYHRLSLNLKQAFPKLQP
PRYNFCKFGSWVGSDRDGNPAVTPDITWQTSCYQRNLVLEKYIQSVNKLINLLTLSQYWS
EVPPGLEKSLGQDQLQMPEVYDRLSIRFLGEPFRFKLSYILKRLENTRDRNQQQAQLIDF
SHPIHPQGMNEQIYYPAAQNFLAELRVVQENLQATGINCQELDTLIGQVEIFGFNLTQLD
IRQESSCHSDALTEIVNYLQILPKPYNELSESERLEWLTQELQTRRPLIPHDLPFSDKTQ
ELINTFRMIRRLQEEFGVEICRTYIISMSHDASDLLEVLLLAKESGLFDPTTASGTLHVI
PLFETVDDLQRAPGVMTQLFDLTFYRNYLVDAQASQEPSSNPPLSLQEIMLGYSDSNKDS
GFLSSNWEIYKAQQRLQETAEPYGVSLRIFHGRGGSVGRGGGPAYEAILAQPGYSVNGRI
KITEQGEVVASKYSLPELALYNLETISTAVIQSSLLRSTMDSIEPWHEIMEDLSARSRKR
YRALIHEQEDLVDFFYEVTPINEISQLQHAARPARRRADNRRTLEGLRAIPWVFSWTQSR
FLLPAWYGVGTALQDFLDEKSAEHLTLLQYFYGKWPFFKMVISKVEMTLAKVDLQIAHHY
LQELTSSEDVDRFERLFEQIAQEYYLTREMVSKITGNQQLLDGDPNLKRSVHLRNGTIVP
LGFLQVSLLKRLRQHQRQDRVALGAGNVSEKDLLRGALLTINGIAAGMRNTG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctaccctcaaccgtaaccatccccaattagtgcagcccaaccggttagagtca
ttgcttctacatcgtattaaagttattgaagacctactggagggtgtcctcagagatgaa
tgcgggcaggagttagtcgatttactgcggcaattgcgatcgatgtgttccccggaagga
caagccccaacggttccggaaacggaagttcttaaggtagtagaaaagctagagctagat
gaagccattcgggccgccagagcctttgccctctactttcagctcatcaatattgtggaa
caacattatgagcaagaggaaagtattgtgcgcacccgaggggcaatcacatcctcccca
gtggcgctgcccaatgttggtggatccgcggagagggctgaaaatcatgcgaacggtcag
accgagctacctgagcacagcatctttgatgccattctgcgggaaccgaatgcagggacc
tttacctggttattccctaagctgaaacagttaaatgttccgccccgccatattcaaaat
attattcaaaacttagatattcagctagtatttacggctcatccgacagaaattgtacgg
cagacaattcgggccaagcagcgtcggattgccaaaattctcggcaagttagatgaggcg
gaggctgggctggccaataatacccgctcaaattgggaggtcgatgccttacaggcccaa
ctgacagaagaagtccgtttttggtggcgcaccgatgaacttcatcaatttagaccaacc
gtgttagacgaagtagagtatagcctgcactatttccgcgaagtcctgtttgatgcgatt
ccccagctctatcaccgtttatccctaaacctgaagcaagcctttcctaagctgcaaccc
cctcgctataacttttgtaagtttgggtcttgggttgggtccgatcgcgatggcaatcca
gcggtgacgccagatattacttggcaaacctcctgttaccaacgcaatttggtccttgag
aaatatattcaatctgtcaataagctaattaacctactgactttgtcccaatattggtct
gaagtgccgccagggttagagaaatctctgggtcaagatcaactccaaatgccggaggtg
tatgacaggctctcgattcggttcttgggagaaccctttcgattcaagttgtcatatatt
ttgaagcgtctggaaaacacccgcgatcgcaatcaacagcaagcgcaactgattgatttc
tcccatccaattcatccccaagggatgaatgaacagatctattaccctgctgctcagaac
ttcttggctgaacttcgagtggttcaagagaacctgcaagcaaccggcatcaattgtcag
gagctagataccctgattggtcaagtggagatctttgggtttaacttaactcagttggat
attcgacaagaaagctcctgccattcagatgccctcactgaaattgttaattacctgcag
attctgcccaaaccctataacgagttgtcagagtccgaacgcttggagtggctaacccaa
gaactgcagacccgcaggcccttgattccccacgatctgcctttctccgacaaaacccaa
gagctcatcaatacgttccgaatgattcgccggctgcaagaagagtttggggtcgaaatt
tgccgcacctacatcatcagcatgagtcatgatgccagtgatttgctggaggtgctgctg
ttagcgaaggagtccggcctatttgatcccacaacggccagtggaacactgcacgttatc
cctctatttgaaacggtggatgatttacagcgagcaccgggggtcatgacccagctattt
gatctaaccttttatcgcaattatttggtggatgcccaggcctctcaggagccgtcttca
aaccctcctctctccttacaagagattatgctgggatattccgatagcaacaaggactct
ggcttcctcagcagtaattgggagatctataaggcccaacaacgattacaggaaactgct
gaaccctatggggtgtctttgcggatttttcatggtcggggcgggtccgtgggccgaggc
ggcgggcctgcctatgaagcgattttggcgcagccaggttatagcgtcaatggtcggatc
aaaattacagagcagggtgaggtggttgcctcaaaatattccttgccggagctggcttta
tacaacctagaaacgatttctacggctgttattcagtccagtttattgcgctccaccatg
gacagtattgaaccctggcatgaaattatggaggatttatcggcgcgatcgcgcaaacga
taccgagcgctgattcatgaacaagaagacttagtggactttttctacgaagtcaccccc
atcaatgaaattagtcaattacaacatgcggctcgacctgctcgacgacgagccgataat
cgccggaccttagaagggttacgcgccattccttgggtgtttagctggacgcaaagccga
tttctgttgcctgcatggtacggagtagggaccgcactccaagattttctagatgagaag
tctgctgaacatctgacgttgctgcaatatttctatggcaaatggccgttctttaagatg
gtgatttctaaggtagaaatgaccttagccaaagtagatctgcaaattgctcatcactat
cttcaggaattgacgtcttctgaagatgtggatcggtttgagcgtttgttcgagcaaatt
gcccaggaatattatctcacccgagagatggtctccaagattacagggaatcagcagctc
ttggatggcgatcctaacctgaagcgttcggtccatctgcggaacggtacgattgtcccc
ttaggatttctgcaggtgtctctgcttaaacggttgagacagcatcagcggcaagatcgg
gttgccttaggcgctggaaatgttagcgagaaagaccttttgcggggcgctttgctgacc
attaacgggattgccgcaggcatgagaaacaccggttag

DBGET integrated database retrieval system