KEGG   Actinoplanes missouriensis: AMIS_23980Help
Entry
AMIS_23980        CDS       T01795                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00250  Alanine, aspartate and glutamate metabolism
ams00280  Valine, leucine and isoleucine degradation
ams00310  Lysine degradation
ams00410  beta-Alanine metabolism
ams00640  Propanoate metabolism
ams00650  Butanoate metabolism
ams01100  Metabolic pathways
ams01120  Microbial metabolism in diverse environments
Module
ams_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMIS_23980
   00650 Butanoate metabolism
    AMIS_23980
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMIS_23980
   00280 Valine, leucine and isoleucine degradation
    AMIS_23980
   00310 Lysine degradation
    AMIS_23980
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMIS_23980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ams01007]
    AMIS_23980
Enzymes [BR:ams01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMIS_23980
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AMIS_23980
    2.6.1.48  5-aminovalerate transaminase
     AMIS_23980
Amino acid related enzymes [BR:ams01007]
 Aminotransferase (transaminase)
  Class III
   AMIS_23980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAL87618
UniProt: I0H3N1
LinkDB All DBs
Position
complement(2508227..2509645)
Genome map
AA seq 472 aa AA seqDB search
MNKRRLVTELPGPRSRALMERKTSAVADGVGTTMPVFAAKAGGGIVVDVDGNQLIDLGSG
IAVTTVGASNPRVVRAVTEQVEAFTHTCFMVTPYDGYVRVAEKLNQLTPGDHDKRTALFN
SGAEAVENAVKIARAYTRRDAVVVFDHAYHGRTNLTLAMTAKNKPYKHTFGPFAPEVYRA
PGSYPYRDGNLDGAAAAARAVDQIEKQIGAENLAALVIEPIQGEGGFIEPAPGFLPALAA
WCRASGVVFVADEVQTGFARTGDLFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMN
AAHEGGLGGTYGGNPIACAAALAAIETIEEDGLGARATEIETLIKERLSRLAVQDLRLAG
VRGRGAMIAVELVREGSTEPDPRLARDVARYAHRHGVIVLTCGTYGNVLRFLPPLTITDE
LLNDAFDVLADALNATAPKAAAQQADALKATALEATAPKATALEATAPEATR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaacggcgcctcgtcaccgaactgcccggtcctcgctcccgggcgctcatggaa
cgcaagacctcggccgtcgccgacggtgtcggcaccacgatgccggtcttcgccgcgaag
gccggtggcggcatcgtcgtcgacgtcgacggcaaccagctcatcgacctcggctcgggc
atcgcggtcaccaccgtcggcgccagcaatccgcgcgtcgtgcgggccgtcaccgagcag
gtcgaggcgttcacgcacacctgcttcatggtcacgccctacgacggatacgtcagggtc
gcggagaagctcaaccagctcacccccggcgaccacgacaagcggaccgcgctgttcaac
tcgggcgccgaggccgtggagaacgccgtcaagatcgctcgggcgtacacccggcgggac
gcggtcgtggtgttcgatcacgcctaccacggccgcaccaacctgacgctcgcgatgacg
gcgaagaacaagccgtacaagcacacgttcggcccgttcgcgccggaggtctaccgggcg
ccgggctcgtacccgtaccgggacggcaatctggacggtgcggccgccgccgcgcgtgcc
gtcgaccagatcgagaagcagatcggcgcggagaacctggcggcgctcgtgatcgagccg
atccagggcgagggagggttcatcgagccggcaccgggcttcctgcccgccctggcggcg
tggtgccgggccagcggcgtggtgttcgtcgccgacgaggtgcagaccggcttcgcgcgg
accggtgacctgttcgcctgtgagcacgagaacgtcgtacccgatctgatcgtgaccgcg
aagggcatcgccggtggcctgccgctctccgcggtgaccggccgggccgagatcatgaac
gccgcgcacgagggtggtctgggcggcacctacggcggcaacccgatcgcctgcgccgcc
gcgctggccgcgatcgagaccatcgaggaggacgggctcggcgcccgggcgaccgagatc
gaaaccctgatcaaggagcgcctgtcacgcttggcggtccaagaccttcgattggcaggg
gtacggggtcgcggcgccatgatcgcggtggagctcgtccgtgagggcagcaccgaaccc
gatccgcgcctcgcccgcgacgtggcccgttacgcccaccggcacggtgtcatcgtgctg
acctgcggcacctacggcaacgtgctgcgtttcctgcccccgctgaccatcaccgacgag
ctgctgaacgacgcgttcgacgttctcgccgacgccctgaacgccaccgccccgaaagcg
gccgcccagcaagccgacgccctgaaagccaccgccctcgaagcaactgccccgaaagcc
accgccctcgaagccaccgccccggaggccacccgatga

DBGET integrated database retrieval system