KEGG   Actinoplanes missouriensis: AMIS_3570Help
Entry
AMIS_3570         CDS       T01795                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ams00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AMIS_3570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ams03400]
    AMIS_3570
Enzymes [BR:ams01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMIS_3570
DNA repair and recombination proteins [BR:ams03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AMIS_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: BAL85577
UniProt: I0GXU0
LinkDB All DBs
Position
373693..374637
Genome map
AA seq 314 aa AA seqDB search
MPGPPLSPMLATAGPLPVGPEWSYEFKWDGVRVLALFGGGPPDLFARSGAVVTAAYPEIA
DLHLPEGTLLDGEMVVFDAAGRPSFTALAERMHVRDKARAARLAVSLPVTYMIFDLLFLD
GMDHTGLPYLARRERLEELGLAGPRWMVPPSFGDGAATADAARENHLEGVMAKRSDSVYL
PGHRSPDWVKVKFDRTGDYVIGGWRPGARKLGGLLIGVPTADGLAFRGRVGGGIGAVAEK
ELLARLEPLASGESPFAPGAVPREDSRGAHWVRPELVAEIRYGNQTPDRRLRFPRFLRLR
DDKTAAECADDEDA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggtccacccctgtcgccgatgctcgcgacggcgggcccgctgccggtggggccg
gagtggagctacgagttcaagtgggacggcgttcgcgtcctggccctgttcggcggcggt
ccgccggacctcttcgcgcgctccggagccgtggtcaccgccgcctacccggagatcgcc
gacctgcatctgccggagggcacgctcctcgacggcgagatggtggtcttcgacgcggcg
ggacggccgtcgttcaccgccctcgccgagcgcatgcacgtgcgggacaaggcacgggcc
gcccgactcgcggtgagcctgccggtgacgtacatgatctttgatttgctctttctcgac
gggatggatcacaccgggttgccctatctggcccgtcgggaacggctcgaggaacttggc
ctcgcggggccacgctggatggtgccgccctcgttcggcgacggcgccgcgaccgccgac
gccgcccgggagaaccacctcgaaggtgtcatggcgaagcgttccgactcggtctacctg
cccggacaccgctcgccggactgggtgaaggtcaagttcgaccggaccggggactacgtg
atcggtggctggcggccgggtgcccgcaaactgggcggcctgctgatcggcgtgccgacc
gccgacggcctggcatttcgcgggcgggtcggcggcggcatcggcgcggtcgccgagaag
gagctgctggcccggctcgagccactcgcctccggcgagtcgcccttcgcccccggcgcg
gtgccgagggaggattcgcgcggagcccattgggtacgcccggagttggtcgccgagatc
agatacggcaaccagacgcccgaccgtcgtctgcggttcccccggttcctgcggctgcgc
gacgacaagaccgccgcggagtgtgccgacgatgaagacgcctga

DBGET integrated database retrieval system