KEGG   Actinoplanes missouriensis: AMIS_46640Help
Entry
AMIS_46640        CDS       T01795                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00250  Alanine, aspartate and glutamate metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams02024  Quorum sensing
Module
ams_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMIS_46640
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMIS_46640
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMIS_46640
   00430 Taurine and hypotaurine metabolism
    AMIS_46640
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AMIS_46640
Enzymes [BR:ams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AMIS_46640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAL89884
UniProt: I0HA47
LinkDB All DBs
Position
4888844..4890211
Genome map
AA seq 455 aa AA seqDB search
MKGSMLKHPRSERPAPEVLATADVTIPRHELPAGEMTPDDAYQIVHDELMLDGNARLNAA
TFVTTWMEPQADRLMAECFDKNMIDKDEYPQTAEIEARCVNILSRLWHAPDARQATGCST
TGSSEAAMLGGLALKRRWQRQGRTGRPNLVMGINVQVCWEKFANYWDVEMRLVPMDGDRY
HLSAEEAVALCDENTIGVVAILGSTFDGSYEPVAEICAALDAFQERTGIDVPVHVDAASG
GFVAPFLDRDLVWDFQLPRVSSINVSGHKYGLVYPGVGWIVWRDAQALPEDLIFWVNYLG
DDMPTFALNFSRPGAQVVAQYYNFLRLGFAGYARVQGYARDVATRLAGMIADLGPFELLT
RGDELPVFAFKLRDEVTGYSVFDVSEALRERGWQVPAYTFPKNREDLAALRIVVRRGFTH
DLADLLLEDLRRHVQRLEKQAVPARDATTATGFHH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatccatgttgaagcaccccaggagcgaacggccggcgccggaagtcctcgcg
acggctgatgtgacgatcccccggcacgagttgccggccggggagatgacgccggacgac
gcgtaccagatcgtccacgacgagctgatgctcgacggcaacgcccgtctcaacgcggcc
accttcgtcacgacgtggatggaaccgcaggccgaccgcctgatggcggagtgcttcgac
aaaaacatgatcgacaaggacgagtacccgcagaccgccgagatcgaggcgcggtgcgtg
aacatcctgagccggctctggcacgccccggacgcgcggcaggccaccgggtgctcgacg
accgggtccagcgaggccgcgatgctcggcggtctggccctcaagcgccggtggcagcgg
cagggccggaccggacggcccaacctggtgatggggatcaacgtccaggtctgctgggag
aagttcgccaactactgggacgtggagatgcggctcgtcccgatggacggggaccgttac
cacctctccgccgaggaggcggtggcgctctgcgacgagaacacgatcggcgtggtggcg
atcctcggctcgacgttcgacgggtcctacgagccggtcgcggagatctgcgcggccctg
gacgccttccaggagcgcaccggcatcgacgtcccggtgcacgtcgacgcggcctccggc
gggttcgtcgcgcccttcctcgaccgggacctggtctgggacttccagctgccgcgggtc
tcgtcgatcaacgtctccggccacaagtacggcctggtctaccccggcgtcggctggatc
gtctggcgtgacgcgcaggcgctgcccgaggatctgatcttctgggtcaactacctcgga
gacgacatgcccacgttcgccctgaacttctcccgccccggcgcgcaggtggtggcccag
tactacaacttcctgcgcctgggattcgccggatacgccagggtccaggggtacgcccgg
gacgtcgccacccgcctcgccggaatgatcgccgacctggggccgttcgagctgctcacg
cgcggcgacgaactcccggtcttcgcgttcaagctgcgcgacgaggtcaccggctactcg
gtcttcgacgtctccgaggcgctgcgggaacgcggctggcaggtgcccgcctacacgttc
ccgaagaaccgcgaggacctggccgcgctgcgcatcgtggtccggcgcggcttcacccac
gacctggccgacctgctcctggaggatctgcggcggcacgtgcagcgcctggagaagcag
gccgtgccggcccgcgacgccaccaccgccaccggcttccaccactga

DBGET integrated database retrieval system