KEGG   Actinoplanes missouriensis: AMIS_50430Help
Entry
AMIS_50430        CDS       T01795                                 

Definition
(GenBank) putative beta-ketoacyl synthase alpha subunit
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00253  Tetracycline biosynthesis
ams01056  Biosynthesis of type II polyketide backbone
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
Module
ams_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    AMIS_50430
   00253 Tetracycline biosynthesis
    AMIS_50430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ams01004]
    AMIS_50430
   01008 Polyketide biosynthesis proteins [BR:ams01008]
    AMIS_50430
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     AMIS_50430
    2.3.1.260  tetracycline polyketide synthase
     AMIS_50430
    2.3.1.-  
     AMIS_50430
Lipid biosynthesis proteins [BR:ams01004]
 Polyketide synthase
  Component type
   AMIS_50430
Polyketide biosynthesis proteins [BR:ams01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     AMIS_50430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: BAL90263
UniProt: I0HB76
LinkDB All DBs
Position
complement(5344418..5345686)
Genome map
AA seq 422 aa AA seqDB search
MTRQSVITGIGVVAPGGGDTKQFWDLITAGRTATRRITAFDASAFRSQVAGEVDFDAAAQ
GFSPREIRRMDRVSQFAIACTHQAIEDSGLDLSSVDPGRIGVSVGTAVGAATSLEQEYLV
LSDSGREWLVDARYAGPHLFDHLTPTTLGTEVALAVGAEGPVGVLSTGCTSGIDSVGHAH
QLIAEGAADVVITGASEAAVSPLAAACFDAIKATTPRNDDPAHAARPFDATRNGFVLAEG
AAIMVVEDAERARRRGAHVYAEIGGYATRCNAYHMTGLQADGREMAEAITAALGQSRLPA
DAVGYVNAHGSGTIQNDRHETAAFKRALGAHAYRVPVSSIKSMIGHSLGAIGSIEIAACA
LAIEHAVVPPTANLHHRDPECDLDYVPLVAREQPVGTALTVGSGFGGYQSAMVLRAPRGA
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggcaatcggtgatcaccgggatcggcgtggtcgcgccgggcggtggcgacacc
aagcagttctgggatctcatcaccgcgggtcggacggccacgcgccggatcaccgcgttc
gacgcgtccgccttccggtcgcaggtggccggtgaggtcgacttcgacgccgccgcgcag
gggttcagcccgcgcgagatccgccggatggaccgggtctcgcagttcgcgatcgcctgc
acccaccaggcgatcgaggacagcggactcgacctgagcagcgtggaccccggccggatc
ggggtcagcgtaggcaccgcggtaggcgccgcgaccagcctcgaacaggaatacctggtg
ctgtcggattccggccgggaatggctggtggacgcccggtacgcgggaccgcacctgttc
gaccacctcaccccgaccacactgggcaccgaggtggccctcgcggtcggcgccgagggg
ccggtgggcgtgctctccaccggctgcacctccggcatcgactcggtcggccacgcccac
cagctgatcgccgagggcgcggccgacgtggtgatcaccggagcctccgaggctgcggtg
tccccgctggcggcggcctgcttcgacgcgatcaaggccaccacgccccgcaacgacgac
ccggcgcacgcggcgcggccgttcgacgccacccgcaacggattcgtgctggccgagggg
gccgcaatcatggtggtggaggacgcggagcgggcccggcggcgcggcgcgcacgtctac
gccgagatcggcgggtacgccacccgctgcaacgcgtaccacatgaccggcctgcaggcc
gacgggcgggagatggccgaggcgatcaccgcggcgctgggtcagagccggttgccggcc
gacgccgtcggctacgtcaacgcccacgggtccggcacgatccagaacgaccggcacgag
accgcggcgttcaaacgggccctcggcgcccacgcgtaccgggtgccggtgtcatcgatc
aaatccatgatcggccactcgctcggcgccatcggctcgatcgagatcgccgcctgtgct
ctcgccatcgagcacgcggtggtgccgccgaccgcgaacctgcaccaccgcgacccggag
tgcgacctggactacgtgccgctcgtcgcccgcgagcagccggtcggcaccgcgctcacc
gtcggcagcggtttcggcggctaccagagcgcgatggtgctgcgcgccccccggggagcg
cgccgatga

DBGET integrated database retrieval system