KEGG   Actinoplanes missouriensis: AMIS_57950Help
Entry
AMIS_57950        CDS       T01795                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00564  Glycerophospholipid metabolism
ams01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMIS_57950
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMIS_57950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: BAL91015
UniProt: I0HDC8
LinkDB All DBs
Position
complement(6202240..6203943)
Genome map
AA seq 567 aa AA seqDB search
MMTALSPQYRDDALAALSGAEVDVLVIGGGVVGAGCALDAVTRGLTVGLVEARDFASGTS
SRSSKLIHGGLRYLEMLDFGLVREALRERGLILQRLAPHLARPVRFLYPLKHRGWERLYA
GAGVTLYDAMAASQALPHHRHLTRRGALRACPALRKDSLVGALQYYDGQLDDARHTMFLA
RTAAAYGAHVASRTEVVGFLREGERVTGVRVRDLEHDRTLEIRAQQVINATGVWTDDTQS
LVGERGQFHVRASKGIHLVVPRDRIQSSTGLILRTATSVLFVIPWGRHWIVGTTDTDWNL
DKAHPAASSKDIDYLLDEVNKVLSTPLERADVQGVYAGLRPLLSGESESTSKLSREHSVG
SPVPGLVVVGGGKYTTYRVMARDAVDACVHSLARSVPRCVTDRVPLLGADGYPALWNRRG
LLAASSGLHVARVEHLLGRYGSLITEVLDLIAADPDLGRPIEGAEDYLRAEFVYAAAAEG
ARHLVDVLTRRTRISIETFDRGVVAAPDAAELMGRVLGWTPEQREREVEHYRLRVEAERA
SQEQQDDETADAARLGAPDVVPVRLGF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgccctttctccgcagtaccgggacgacgccctggccgcgctgagcggtgcc
gaggtcgacgtgctggtgatcggcgggggagtggtcggtgcggggtgcgcgctcgacgcg
gtcacacggggactgaccgtgggcctcgtcgaggcgcgcgacttcgcctccggcacctcc
agccgctccagcaagctgatccacggcgggctgcgatacctggaaatgctggatttcggg
ctggtgcgtgaggcgctgcgggagcggggactcatcctgcagcgcctcgcgccgcacctg
gcccgcccggtccggttcctctacccgctcaaacaccgaggctgggagcggctctacgcc
ggcgccggcgtcaccctctacgacgcgatggccgcgtcgcaggcgctgccgcaccaccgg
cacctgacccggcgcggcgcgctccgggcctgcccggcgctgcgcaaggactcgctggtc
ggcgcgctgcagtactacgacgggcagctcgacgacgcccggcacaccatgttcctggcg
cgcaccgcggccgcctacggcgcccacgtcgcgtcgcgcaccgaagtggtcgggttcctg
cgcgagggcgagagggtcaccggggtacgggtccgcgacctcgagcacgaccggaccctg
gagatccgcgcccagcaggtgatcaacgcgaccggggtgtggaccgacgacacccagtcc
ctggtcggcgaacgcggccagttccacgtccgcgcctccaagggcatccacctcgtggtg
ccccgcgaccggatccagtcctcgaccgggctgatcctgcggaccgccaccagcgtgctg
ttcgtgatcccctggggccggcactggatcgtcggcaccaccgacaccgactggaacctc
gacaaggcgcacccggccgcgtccagcaaggacatcgactacctgctggacgaggtcaac
aaggtgctctccacgcccctggaacgcgccgacgtgcagggcgtctacgccgggctgcgg
ccgctgctctccggcgagtccgagtcgacctcgaaactgtcccgggagcactcggtgggc
agcccggtgccgggactggtcgtggtcggcgggggcaagtacacgacgtaccgggtgatg
gcccgggacgccgtggacgcgtgcgtgcacagcctggcccgctcggtgccgcgctgcgtg
acggaccgggtgccgctgctcggcgcggacgggtacccggcgctgtggaaccggcgcggg
ctgctcgccgcgtcgtccgggctgcacgtggcacgcgtcgaacacctcctcggccggtac
ggctcgctgatcaccgaggtgctcgacctgatagccgccgacccggacctgggccgcccg
atcgagggcgccgaggattatctgcgagccgagttcgtctacgcggcggctgccgagggc
gcccggcacctggtggacgtgctcacccgccgtacccggatctccatcgagacgttcgac
cggggtgtcgtggcggcgccggacgcggccgagctgatgggacgggtgctggggtggaca
cccgaacagcgcgaacgggaggtggagcactaccgcctgcgcgtcgaggcggaacgggcg
tcccaggaacagcaggacgacgagacagcggacgcggcccggctcggcgccccggacgtg
gtcccggtccgcctcggattctga

DBGET integrated database retrieval system