KEGG   Actinoplanes missouriensis: AMIS_58740Help
Entry
AMIS_58740        CDS       T01795                                 

Definition
(GenBank) putative glycosyltransferase
Organism
ams  Actinoplanes missouriensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 DUF5472 Glyco_tranf_2_4 DUF4671
Motif
Other DBs
NCBI-ProteinID: BAL91094
UniProt: I0HDK7
LinkDB All DBs
Position
complement(6290381..6291766)
Genome map
AA seq 461 aa AA seqDB search
MTGGVASPAGRGRHRRVPEHYRRALLTHVLVLAAALALFGVDRTLGWAATVLNVVFLLFF
FRHLAFAVSAARWAERDLDAPVVGIETYTPTIAVLVACKDEELVVDGMVAAMLDLSYPPS
ALTVVVVDDASTDGTGAKLDAWHVANPRLRVLHRPPGAGGGKSGALNDALALVDAEIAVI
FDADHQPEPSVLRRLVRHFRDPRVGAVMGRCVVRNGVESNLASTIFIDYLSGYLVNEYGR
QALFELPAYGGANCAVRTDLIRALGGWNPHTVTEDTDLTLRLLLDGYRVRYDSTAVDFEE
AVLSNSRFWRQRYRWARGHQKCLRDYWRPVVVTPHLSLMEKLETILFLWVYHVPVLCGLG
LILIGLRAFGIGGSSLLQMIALSALLFAGPFTELAVGLVLGRVSRKAVWMLIGFIPAFGM
SILTATKAYLDGMWGTTYSWSKTARSGATSAPVKAPLPEAA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcggcgtggcgtcccctgccggacgggggcgccaccgccgcgtgccggagcac
taccgtcgcgctctgctcacccacgtcctggtcctcgccgcggcgctcgcgctgttcggc
gtggaccggacgctgggctgggccgcgacagtgctcaacgtcgtgttcctgctcttcttc
ttccggcatctcgcgttcgcggtctcggcggcccgctgggcggaacgcgatctcgacgcg
cccgtcgtcggcatcgagacctacacccccacgatcgccgtcctggtcgcctgcaaggac
gaggaactcgtggtcgacggcatggtggcggccatgctggacctgtcctatccgccctcg
gcgctgaccgtggtcgtcgtcgacgacgcctccaccgacggcaccggcgcgaaactcgac
gcctggcacgtggccaacccgcggctgcgggtgctgcaccggccgcccggcgccggcggc
ggcaagtccggcgccctcaacgacgccctcgccctggtcgacgcggagatcgcggtcatc
ttcgacgccgaccaccagcccgagccgagcgtgctgcgccggctcgtccggcatttccgg
gatccgcgggtgggcgcggtgatggggcgctgcgtggtccgcaacggcgtcgagtcgaac
ctcgcgtccacgatcttcatcgactacctgtccggctatctggtcaacgagtacggccgg
caggcgctgttcgaactgcccgcgtacggtggcgcgaactgtgcggtccgcaccgatctg
atccgggcgctcggcggctggaacccgcacaccgtcaccgaggacaccgacctcacactg
cggctgctgctcgacgggtaccgggtccgctacgactcgacggctgtcgacttcgaggaa
gcggtgctgtcgaacagccggttctggcggcagcggtaccgatgggcgcgcggccatcag
aagtgtctgcgggactattggcggccggtcgtcgtcacgccgcatctgtccctgatggag
aagctggagacgatcctcttcctctgggtctaccacgtgcccgtcctgtgcggactcggg
ctgatactgatcggcttgcgggcgttcgggatcggcggctcgtcgctgctccagatgatc
gcgctctccgccctgctcttcgccggacccttcaccgagctcgccgtcggactggtcctg
ggccgggtctcccgtaaggccgtctggatgctgatcgggttcatccccgccttcgggatg
tcgatcctgaccgccaccaaggcctacctcgacggcatgtggggcaccacctacagctgg
tccaagacggcccggtccggcgccaccagcgcacccgtgaaggcgccgctcccggaggcg
gcatga

DBGET integrated database retrieval system