KEGG   Actinoplanes missouriensis: AMIS_61430
Entry
AMIS_61430        CDS       T01795                                 

Definition
(GenBank) putative glycosyl hydrolase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00052  Galactose metabolism
ams00500  Starch and sucrose metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AMIS_61430
   00500 Starch and sucrose metabolism
    AMIS_61430
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AMIS_61430
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C
Other DBs
NCBI-ProteinID: BAL91363
UniProt: I0HEC6
LinkDB
Position
complement(6603381..6605177)
AA seq 598 aa
MIPHHDGSALYVSNPAPALGETVAVFVRAPAGTRISRIHTRFVRDGEPVFTSAVVDRRDA
SGEWWRAEVEVRNPITPYRFLIRTATGAVRWLTAGGLTSYDVPDATDFRLVAHPPAPDWS
RDAIVYQIFPDRFARSAAADGRPTPDWAVRCDWDTPVEGRGPLAATQLYGGDLDGIAEHL
DHVADLGANTLYLTPFFPSRSNHRYDGADFGTVDPLLGGDTALVRLTEAVHARGMRVIGD
LTTNHTGDTHEWFRSEKDFYYVDDDGGYESWLGVPSLPKLNWGSPELRRRFAKLAQHWLT
YPYALDGWRIDVANMTGRRGADDWTREVAALLARAVRQVRPDAMLLAEHGHDATGDLDAD
GWQGTMNYAGFTRPVWSWLRDDEVPFPDFLGVPEEIPLRDAADLVSTMTAFAARTSWRSR
VASWQILSSHDTPRIRSVVGGPERHEVAAGLLFTLPGTPMIFAGDELGLTGYNGEHSRTP
MPWNDTGGWDMRTLARHRALARLRGGTPALRDGGLRWLHATGDLLVFLRETAADTVLVVA
RRAPGLPVRVTGLVPHAWGDNLYGGAEALKSGADGSIEIDGDGPTFQVWSVRQHPKGC
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgatcccgcaccacgacggctccgccctctacgtctccaacccggcgcccgcgctgggg
gagacggtcgccgtcttcgtccgggcgccggccggcacccggatctcgcggatacacacc
cggttcgtccgcgacggcgaaccggtcttcacctcggcggtggtcgaccggcgggacgcg
tccggcgagtggtggcgggcggaggtcgaggtccggaacccgatcaccccgtaccgtttc
ctgatccggaccgcgaccggcgcggtccgctggctcaccgcagggggtctgacctcctac
gacgtgccggacgccaccgacttccggctggtcgcgcacccgccggcgccggactggtcg
cgggacgcgatcgtctaccagatcttcccggaccggttcgcccgctcggcggcggcggac
gggcggccgacgccggactgggccgtgcgctgcgactgggacaccccggtcgaagggcgt
ggcccgctggccgccacccagctctacggcggcgacctggacggcatcgccgaacacctg
gaccacgtcgccgacctgggcgcgaacacgctctacctgacgccgttcttcccgtcccgc
tcgaaccaccgctacgacggcgccgacttcggcacggtcgacccgctgctcggcggcgac
accgcgctggtccggctcaccgaggcggtgcacgcgcggggcatgcgcgtgatcggcgac
ctcaccaccaaccacaccggcgacacccacgagtggttccggtcggagaaggacttctac
tacgtcgacgacgacggcgggtacgagtcctggctcggcgtccccagcctgccgaagctg
aactggggcagccccgagctgcgccgccggttcgcgaaactggcacagcactggctcacc
tacccctacgcgctggacggctggcggatcgacgtcgcgaacatgaccggccggcggggc
gccgacgactggacccgggaggtcgccgcgctgctcgcccgggccgtgcggcaggtccgc
ccggacgccatgctgctcgccgagcacggccacgacgcgaccggcgacctggacgcggac
ggctggcagggcaccatgaactacgccggcttcacgcgtccggtgtggagctggctgcgc
gacgacgaggtgccgttcccggacttcctcggcgtgccggaggagatcccgttgcgggac
gcggccgacctggtgtcgaccatgacggcgttcgcggcgcggacgtcctggcgttcccgc
gtcgcgtcctggcagatcctcagctcgcacgacaccccgcggatcaggtccgtggtcggc
ggcccggaacgccacgaggtcgccgccggtctgctcttcacgctccccggcaccccgatg
atcttcgcgggtgacgagctgggcctgaccggatacaacggcgagcactcccgtaccccg
atgccctggaacgacaccggcggctgggacatgcgcaccctggcccggcaccgcgccctg
gcgcggctgcgcggcggaacgccggcgctgcgcgacggtggcctgcgctggctgcacgcc
accggtgacctgctggtcttcctcagggagaccgcagcggacacggttctggtggtggcc
cggcgcgcgcccggccttccggtacgcgtgaccggactcgtcccgcacgcgtggggcgac
aacctgtacggcggcgccgaagccctcaaatccggcgccgatggatctatcgaaatcgac
ggtgatggaccaaccttccaggtgtggtccgtccgccagcacccgaagggttgttaa

DBGET integrated database retrieval system