KEGG   Actinoplanes missouriensis: AMIS_68130Help
Entry
AMIS_68130        CDS       T01795                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
Organism
ams  Actinoplanes missouriensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAL92033
UniProt: I0HG96
LinkDB All DBs
Position
7383890..7384957
Genome map
AA seq 355 aa AA seqDB search
MQLPLSPPVKPMLAKPVADIPPDQVYEPKWDGFRSIVFRDGDEVEIGSRNEKPMTRYFPE
VVTAVLANFPERAVIDGEVIVADTERNTLDFEALQQRIHPAASRVRLLAEQTPASFVAFD
LLALGDEDLTELPFVQRRARLLEALKDAKPPVYVTPATDDTAEARRWFEQFEGAGLDGLI
AKPRDLVYQPDKRVMFKIKHKRTADCVVAGYRIHKSGPDRIGSLLLGLHDERGVLVSVGV
IGSFPMKVREELFAELQPLVTTFEGHPWNWAAHEQGERTPRKNEYSRWNNGKDLSFTPLR
PERVVEVRYDYMEGARFRHTAQFERWRPDRDPATCTYDQLERPVRFDLAEVLNGR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttccgctcagcccgccggtcaagccgatgctcgccaaaccggtcgccgacatc
ccacccgaccaggtctacgagcccaaatgggacggattccggtcgatcgtcttccgggac
ggcgacgaggtggagatcggcagccgcaacgagaagccgatgaccaggtacttcccggag
gtggtgaccgccgtcctggcgaacttcccggagcgggcggtgatcgacggcgaggtgatc
gtcgccgacaccgagcggaacaccctcgacttcgaggcgctccagcagcgcatccacccg
gcggccagccgggtcaggctgctcgccgagcagacgccggcgagtttcgtggcgttcgac
ctgctggcgctcggcgacgaggacctcaccgagctgcccttcgtccagcgccgggcccgc
ctgctggaggccctgaaggacgcgaaaccgccggtgtacgtcacccccgccaccgacgac
acggcggaggcgcggcgctggttcgagcagttcgagggcgccggtctggacgggctgatc
gccaagccacgggacctggtctaccagcccgacaagcgggtcatgttcaagatcaagcac
aagcggacggcggactgcgtggtcgccggctaccggatccacaagtccggccctgaccgg
atcggatcactgctgctcggcctgcacgacgagcgcggcgtgctcgtctcggtcggcgtg
atcggctccttcccgatgaaggtccgcgaggagctcttcgccgagctgcagcctctggtc
acgacgttcgaggggcacccctggaactgggccgcgcacgagcagggcgagcgcaccccg
cgcaagaacgagtacagccggtggaacaacggcaaggacctgtcgttcacgccgctgcgc
ccggagcgggtggtcgaggtccgctacgactacatggagggcgcccgcttccggcacacc
gcccagttcgaacggtggcggcccgaccgggacccggccacctgcacctacgaccagctc
gagcggccggtccggttcgatctcgccgaggtgctcaacggtcgctga

DBGET integrated database retrieval system