KEGG   Actinoplanes missouriensis: AMIS_72480Help
Entry
AMIS_72480        CDS       T01795                                 

Definition
(GenBank) putative glycosyl hydrolase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00500  Starch and sucrose metabolism
ams01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_72480
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMIS_72480
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMIS_72480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: BAL92468
UniProt: I0HHI1
LinkDB All DBs
Position
complement(7859295..7860941)
Genome map
AA seq 548 aa AA seqDB search
MSDRWYENAVVYCLDIDSFADSDGDGCGDIRGLIGRLDYLARLGVTCLWLNPIHPSPGRD
DGYDASDFYNVDPRFGSLGDFAELLHEAGNRGIKVIIDLVVNHTSDQHPWFQSARSSPES
PYRDWYVWSETAPPDRNQGMVFPGEQNETWSYDRTAKLWFYHRFYKFQPDLNIKNPAVRE
EIKKICSFWLQLGVAGFRMDAVPFIIEETEPGNPNSPKDMNFLSELRQHVQWRRGDAVLL
AEANVEPDQLVRFFGDEGGSGNRIHMLFDFMLNARLVLGLAREDTEPIIDALRDSPKLPE
GGQWATFLRNHDEIDLSRLTADQRQDVFARFGPDEDMQLYGRGIRRRLAPMLGNDRRWLE
LAYALQFSLRGTPVLRYGEEIGMGDDLSLKGRDAIRTPMQWSMLPSGGFTSADPSKLGRP
VISGGEFGFEKVNVTVQRQDPRSLLSWFERMIRTLKEAPEIGRGTCTHVDVPAPRGVLVH
RADAATGTMVFVHNLGTEPAVVDLGSLAEEAELPNDVLADQEYPEPGKLDEIRVEGHGYR
WIRLRRTA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccggtggtacgagaacgcggttgtctactgtctcgacatcgactccttcgct
gactccgacggggacggctgtggggacatccgggggctgatcgggcgcctggactacctg
gcacggctcggtgtgacgtgtctctggctgaacccgatccacccctcgccggggcgggac
gacggttacgacgcgtcggacttctacaacgtggatccgcggttcgggagtctcggggac
ttcgccgaactgctgcacgaggccggcaaccggggcatcaaagtcatcatcgacctggtc
gtcaaccacacctcggaccagcacccgtggttccagagtgcacggagctcgccggagtcg
ccgtaccgggattggtatgtctggagcgagaccgcaccgccggaccgtaaccagggcatg
gtcttccccggcgagcagaacgagacctggagctacgaccggacggcgaagctctggttc
tatcaccggttctacaagttccagccggacctcaacatcaagaacccggcggtgcgcgag
gagatcaagaagatctgttcgttctggctgcagctcggggtggccgggttccggatggac
gcggtgccgttcatcatcgaggagaccgagccgggcaacccgaactcgccgaaggacatg
aacttcctgtccgagctgcgccagcacgtgcagtggcgacgcggtgacgcggtgctgctg
gccgaggccaatgtggagcccgatcagctggtgcggttcttcggtgacgagggcggctcc
ggcaaccggatccacatgctgttcgacttcatgctcaacgcgcggctcgtgctcggcctg
gcgcgcgaggacaccgagccgatcatcgacgcgttgcgggactcgccgaaactgccggag
ggcgggcagtgggccacgttcctgcgcaaccacgacgagatcgacctgtcccggctcacc
gctgatcagcggcaggacgtgttcgcccggttcggcccggacgaggacatgcagctgtac
gggcgtggtatccgccgccggctcgcgccgatgctcggcaacgaccggcgctggctggag
ctggcgtacgcgctgcagttcagcctgcggggcacgccggtgctgcggtacggcgaggag
atcggcatgggcgacgacctgtcgctcaagggccgggacgcgatccgcacgccgatgcag
tggtcgatgctgccgagcggcgggttcaccagcgcggacccgtcgaagctgggccggccg
gtgatctccggtggcgagttcggcttcgagaaggtcaacgtgacggtgcagcgacaggac
ccgcggtcgctgctgtcctggttcgagcggatgatccgcaccctcaaggaggcgccggag
atcggccgggggacctgcacccacgtcgacgtgccggcgccgcgtggcgtgctggtgcac
cgggccgacgccgctaccggaacgatggtgttcgtgcacaatctcggcaccgaaccggcc
gtggtcgatctgggcagtctcgccgaggaggccgagcttcccaacgacgtgctggccgac
caggagtacccggaacccggcaagctggacgagatccgggtcgaggggcacggttaccgg
tggatccggctgcgcaggacggcctga

DBGET integrated database retrieval system