KEGG   Actinoplanes missouriensis: AMIS_72860Help
Entry
AMIS_72860        CDS       T01795                                 

Gene name
sodN
Definition
(GenBank) putative superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ams  Actinoplanes missouriensis
Brite
KEGG Orthology (KO) [BR:ams00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMIS_72860 (sodN)
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMIS_72860 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A BtrH_N
Motif
Other DBs
NCBI-ProteinID: BAL92506
UniProt: I0HHL9
LinkDB All DBs
Position
7903140..7903544
Genome map
AA seq 134 aa AA seqDB search
MRLPRFLTPRTVVSAHCDLPCGVYDPAQARIEAESIKAIAEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPNLHQLFNEATKLAGAAGAKGSVDPSVAEQLLGK
IEEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccgcgtttcctcacgccgcgcaccgtggtcagcgcgcactgtgacctgccc
tgcggggtctacgacccggcccaggcccggatcgaggccgagtcgatcaaggcgatcgcc
gagaagtaccaggcgaacaccgacccggagttccgcacccgggccatcctgatcaaggag
cagcgcgccgagctggtcaagcaccacctgtgggtgctctggaccgactacttcaaggcg
ccgcacttcgagaagtacccgaacctgcaccagctcttcaacgaggccaccaagctggcc
ggcgccgccggcgccaagggctcggtcgacccgtcggtcgccgagcagctgcttggaaag
atcgaggagatctccaagatcttctgggagaccaagcaggcctga

DBGET integrated database retrieval system