KEGG   Actinoplanes missouriensis: AMIS_7460Help
Entry
AMIS_7460         CDS       T01795                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00620  Pyruvate metabolism
ams00680  Methane metabolism
ams01100  Metabolic pathways
ams01120  Microbial metabolism in diverse environments
ams01200  Carbon metabolism
Module
ams_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_7460
  09102 Energy metabolism
   00680 Methane metabolism
    AMIS_7460
Enzymes [BR:ams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AMIS_7460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: BAL85966
UniProt: I0GYX9
LinkDB All DBs
Position
complement(798070..800865)
Genome map
AA seq 931 aa AA seqDB search
MTEPPAHLDREGSDAALRADIRRIGTLLGQTLARQEGRPLLDLVEEIRALVRQDAPAAAD
RLSAMDITTGTKLARAFSTYFHLANITEQVHRARDLQRRRARDGGWLDQAAARISEKGVP
AEEIAAAARRLAVRPVFTAHPTEAARRSILSKLRQVADSLDAESAAAALYGATDTTVSTK
RFAELIDLLWQTDELRLDRPDPTDEARNAVYYLKDLYAEAAPQVLDDLAETLRRLGVETA
PTSRPLTFGTWIGGDRDGNPFVTPKVTRDVLLIQHEHGIQATEKAMDKLIDELSVSRRLR
GVSLDLSASLAQDLDNLPEIAARFRRVNAEEPYRLKVRAVKAKLANTRARLTNNTPHVPG
RDYLGSDELISDLELMRASLARNSGQLPAIGIVATAIRQASAFGLQLATLDVREHAEKHH
EVLQQMYTQVGEIDDYATLDRSDRTKLLATELTGRRPLSSADTPLTDSARKTFDVFNTIR
EAQDSFGPDVIETYIISMTLGVDDVLAAAVLAREAGLVDIHTGRARVNIVPLLETPAELD
AGGDLLDEMLSLPAYREIVRARGDVQEVMLGYSDSNKEAGITTSQWRIHKAQRSLRDVAA
RHGVRLRLFHGRGGTVGRGGGPTHEAILAQPYGTLDGAIKVTEQGEVISDKYTVPALARE
NLELTVAAVLQATLLHTTLQVDPVRLKVWDSVMDTASDAAFTQYRSLVENPDLAAYFWAA
TPTELLGALNIGSRPAKRPNADAGLSGLRAIPWVFGWTQTRQIVPGWFGVGTGLAAVRAA
GLGNELDAMHENWQFFRTFLSNVEMMLAKTDLSIARRYVETLVPEELHPIFHKIEREYEL
TVQEVLAITGGTELLSSQPELSRTLGVRDTYLEPLHHLQVALLRQYRDLDDAGRQIPTAP
GARRGPSDSTALERALLTTVNGIAAGMRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgcctgcccatctcgaccgcgagggttcggacgcagccctccgtgccgac
atccgccggatcggcacgctgctcgggcagaccctggcccgccaggaaggccggccgctg
ctcgacctggtcgaggagatccgggccctggtccgccaggacgccccggccgccgccgac
cggctttccgccatggacatcaccaccggcacgaagctggcccgcgccttctccacctac
ttccacctggccaacatcaccgagcaggtgcaccgcgcccgcgacctccagcgccgccgg
gcccgtgacggcggatggctggaccaggccgccgcgcggatctccgagaagggcgtgccg
gccgaggagatcgccgcggccgcccgccggctcgcggtccgcccggtcttcaccgcgcac
ccgaccgaggccgcccgccgctcgatcctgtcgaagctgcgccaggtcgccgactcgctg
gacgccgaatcggccgccgcggccctgtacggcgcgaccgacaccacggtctccaccaag
cggttcgccgagctgatcgacctgctctggcagaccgatgagctgcgcctggaccggccg
gacccgaccgacgaggcgcgcaacgcggtctactacctcaaggacctctacgccgaggcc
gcaccgcaggtgctcgacgacctcgccgagacgctgcgccggctcggcgtggagaccgcg
cccacctcacggccgctcacgttcggcacctggatcggcggcgaccgcgacggcaacccc
ttcgtcaccccgaaggtcacccgcgacgtcctgctcatccagcatgagcacggcatccag
gccaccgagaaggcgatggacaagctgatcgacgagctgtccgtctcccggcggctgcgc
ggcgtctccctggacctgtccgcgagcctcgcccaggacctggacaacctgccggagatc
gcggcccggttccgccgggtcaacgcggaggagccgtaccggctgaaggtccgcgcggtc
aaggcgaagctggcgaacacccgggcccggctcaccaacaacaccccgcacgtgcccggc
cgcgactacctcggcagcgacgagctgatcagcgacctggagctgatgcgcgcctcgctt
gcccgcaactccggccagctgcccgccatcggcatcgtcgccaccgcgatccgccaggcg
tccgcgttcggcctgcagctcgccaccctcgacgtgcgcgagcacgccgagaagcaccac
gaggtgctgcagcagatgtacacgcaggtcggcgagatcgacgactacgcgacgctggac
cgcagcgaccggaccaagctgctcgccaccgagctgaccggtcggcgcccgctctccagc
gccgacaccccgctcaccgactcggcccgcaagaccttcgacgtgttcaacacgatccgc
gaggcgcaggacagcttcgggccggacgtcatcgagacctacatcatctcgatgaccctc
ggtgtcgacgacgtgctggcagcggccgtgctggcccgcgaggccggcctggtcgacatc
cacaccggccgggcccgggtcaacatcgttccgctgctggagacgccggccgagctcgac
gccggtggcgacctgctggacgagatgctgtccctgccggcctaccgggagatcgtccgg
gcgcgcggcgacgtgcaggaggtcatgctcgggtactcggactcgaacaaggaagccggc
atcaccaccagccagtggcgcatccacaaggcgcagcggtcgctgcgtgacgtggccgcc
cggcacggtgtgcggctgcgcctcttccacggccgcggcggcaccgtcggccgcggcggc
ggccccacccacgaggcgatcctggcccagccgtacggcacgctcgacggcgccatcaag
gtcaccgagcagggcgaggtcatctccgacaagtacaccgtgccggccctggcccgggag
aacctggaactgaccgtggcggccgtcctccaggccaccctgctgcacaccacgctgcag
gtcgacccggtccggctcaaggtctgggactcggtcatggacaccgcctcggacgcggcg
ttcacccagtaccggtcgctcgtcgagaacccggacctggccgcgtacttctgggcggcc
acaccgaccgagctgctcggcgccctgaacatcggctcccgcccggcgaagcgccccaac
gcggacgccggcctgagcggtctgcgggccatcccgtgggtgttcggctggacacagacc
cggcagatcgtgcccggctggttcggcgtcggcaccggcctcgccgcggtccgcgccgcc
ggcctcggcaacgaactcgacgccatgcacgagaactggcagttcttccgcacgttcctc
tcgaacgtcgagatgatgctggccaagaccgacctgtcgatcgcccggcgctacgtcgag
accctggtccccgaggaactccacccgatcttccacaagatcgagcgggagtacgagctg
accgtccaggaagtcctggcgatcaccggcggcaccgagctgctctcctcgcagcccgag
ctgtcccggacgctgggcgtgcgggacacctacctggagccgctgcaccacctgcaggtg
gcgctgctgcgtcagtaccgcgacctcgacgacgcgggccgccagatcccgacggcgccg
ggcgcccgccgaggcccgtccgactcgacggccctggagcgtgccctcctcaccaccgtc
aacggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system