KEGG   Actinoplanes missouriensis: AMIS_76010Help
Entry
AMIS_76010        CDS       T01795                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00260  Glycine, serine and threonine metabolism
ams00680  Methane metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
ams01230  Biosynthesis of amino acids
Module
ams_M00002  Glycolysis, core module involving three-carbon compounds
ams_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_76010
  09102 Energy metabolism
   00680 Methane metabolism
    AMIS_76010
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_76010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ams04131]
    AMIS_76010
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ams04147]
    AMIS_76010
Enzymes [BR:ams01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AMIS_76010
Membrane trafficking [BR:ams04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AMIS_76010
Exosome [BR:ams04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AMIS_76010
  Exosomal proteins of melanoma cells
   AMIS_76010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAL92821
UniProt: I0HII4
LinkDB All DBs
Position
complement(8221602..8222351)
Genome map
AA seq 249 aa AA seqDB search
MTGTLVLLRHGNSEWNAKNLFTGWVDVDLDAKGEDEARRGGELLKEQNVLPDVVHTSLLR
RAIRTSEIALHLTDRHWIPVKRSWRLNERHYGALQGKDKKQTLEAYGEEQFMLWRRSYDV
PPPPIEDDSEFSQFGDARYANLPPELLPKAECLKDVLERALPYWYDEIVPDLRAGKTVLV
AAHGNSLRAIVKHLDQVSDSAIAKLNIPTGIPLRYDLDDNLRPTNPGGEYLDPVAAKEAA
AAVANQGKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccctggtgctgctgcgacacggcaacagcgagtggaacgccaagaacctc
ttcaccggctgggtcgacgtggacctggacgccaagggtgaggacgaggcccgtcgtggt
ggcgagctgctcaaggagcagaacgtgctgcccgacgtggtgcacaccagccttctccgt
cgcgcgatccggaccagcgagatcgcgctgcacctcaccgaccgtcactggatcccggtg
aagcgctcgtggcggctgaacgaacgccactacggcgcgttgcagggcaaggacaagaag
cagaccctcgaggcgtacggcgaggagcagttcatgctctggcgccggtcgtacgacgtg
cccccgcccccgatcgaggacgactccgagttctcccagttcggtgacgcgcggtacgcc
aacctcccgcccgagctgctgccgaaggcggagtgcctgaaggacgtcctggagcgggcc
ctgccctactggtacgacgagatcgtcccggacctgcgcgccggcaagacggtcctggtc
gccgcgcacggcaactcgctgcgcgcgatcgtgaagcacctggaccaggtctcggactcc
gcgatcgccaagctgaacatcccgaccggcatcccgctgcgctacgacctggacgacaac
ctgcgcccgaccaacccgggcggcgagtacctcgacccggtcgccgcgaaggaagccgcc
gccgcggtggcgaaccagggcaagaagtaa

DBGET integrated database retrieval system