KEGG   Alkaliphilus metalliredigens: Amet_0590Help
Entry
Amet_0590         CDS       T00551                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00040  Pentose and glucuronate interconversions
amt00051  Fructose and mannose metabolism
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amet_0590
   00051 Fructose and mannose metabolism
    Amet_0590
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Amet_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABR46817
UniProt: A6TKU9
LinkDB All DBs
Position
620247..621287
Genome map
AA seq 346 aa AA seqDB search
MKNRAVFMQGTDNMVTKDVPMPKIKEKDVLIKVDIVGICGSDVHYYKHGKIGDFVVEGEF
ILGHEAAGEVVEVGEQVKGLTVGDRVTMEPGKTCGKCEFCKGGKYNLCPDVEFFATPPYH
GVLTNYVSHPEDMCFKLPKNVSNVEGALVEPLAVGLHASDQGGVKLGDTVVIFGTGCIGL
MTIISCKAKGAAKIIVVDILENRLEVAKKVGATDTINAKEVNVLKKIQELTDGKGAEVVI
DAAGAAITVKQTVDAVKPGGTIVLVGMTPKDEVEFNFMKLMGKEAEVKTVFRYRNLYPIA
INAIASGAINIKDIVSHEFDFEQTKEAFDFVAEHASDVVKAVIKIK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagagcagtctttatgcaaggtacagataacatggttactaaggatgtgcca
atgccaaagataaaagaaaaagacgtactaataaaagtagatattgttggtatatgtggt
tcggatgttcattattataaacatggtaaaattggtgacttcgtggttgaaggagagttt
atcctaggacatgaagctgccggtgaagttgtagaagtcggggaacaggtaaagggatta
actgttggggatcgagtgactatggaacctggtaagacttgtgggaaatgtgaattttgc
aagggtggaaaatataacctttgcccagatgtggaattctttgcgacgcctccttatcat
ggtgtgttgactaactatgtctctcaccctgaggacatgtgtttcaaactaccaaaaaat
gtgtcgaatgtagaaggcgctttagtggaaccacttgcagttgggttgcacgcatctgat
caaggtggagtcaagctaggtgatactgttgtgattttcggaaccgggtgcattggccta
atgacaatcatttcctgtaaagccaaaggtgctgccaagataattgttgttgatatattg
gagaatagacttgaagttgcaaaaaaagtaggtgcaacggatacaattaatgcaaaagaa
gttaacgtattaaagaaaatacaagaactaaccgacggtaaaggtgcagaggttgtgatt
gatgcagcaggagccgccattacagtcaaacaaacagtagatgctgttaagcctggtggt
accatcgttttggttggtatgacacctaaagatgaagtagaattcaactttatgaagcta
atggggaaagaagcagaagtaaaaacagtgttccgttatcgtaatttatatccaattgca
attaatgccattgcaagtggagcaatcaatataaaagatatcgtgagccatgagtttgac
tttgagcagaccaaggaagcctttgattttgttgctgaacacgcaagcgatgtagtcaaa
gctgtgattaagataaagtaa

DBGET integrated database retrieval system