KEGG   Alkaliphilus metalliredigens: Amet_1091Help
Entry
Amet_1091         CDS       T00551                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
amt  Alkaliphilus metalliredigens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3
Motif
Other DBs
NCBI-ProteinID: ABR47303
UniProt: A6TM85
LinkDB All DBs
Position
complement(1143179..1144375)
Genome map
AA seq 398 aa AA seqDB search
MYGIPHLKFKKDIWFLLASILIIHIAAYIIVPIFPILLRGQKGLNPTQIGLVIGAGSLFI
QLGSIVAGFISSRLGNKLAMVIGNACQAIALFGLGSVHTLYPLILFSSLNGIGTGIYVPT
VKSAISYIASEENRTTAFSMRGVAAHAGTSVAGIFVLLSAVNRNFYIASGIYIVLMIISW
IYLPTNCGEEPCPPLPFNRYIEIFKNRTFMNFTFVSIFLWALHTQLNFLLPLRGEAILDN
TNIIGTIWTITSVTVILIQPFISQMFLNKISPKLSICIGSILVGSGVTLIGWANSFYFLV
LCAIIFILGEMFMMPTLDSVTSLIADPKMIGAYFGVANLASGIGAAFGTFASGRLIDLYG
ITESVLPWVMYGIATVVISGLIFLPAIKTLDQNNEGAK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtattccacatttaaaatttaaaaaggatatttggtttttactagcttctatc
ctcattatacatatagcagcttatatcattgtccccattttccccattttacttcgaggg
cagaaggggttaaatcccacacagatcggtttagtcatcggtgccggctctctctttatt
caactgggaagtattgttgcaggatttatttctagtcgcttgggcaataaactggccatg
gtaatcggtaatgcctgccaagctattgccttatttggattaggttcggtccataccctc
tatcctttgattctgttttcttcattaaacggcattggtactggaatctatgttcctact
gtcaagtcagcaatttcttatatcgcttcagaggaaaaccgcaccactgctttttctatg
cggggtgtggctgcccatgctggcacaagtgttgctggtattttcgttcttctttcagct
gtaaatcgaaatttttatattgcatcaggtatctatattgttttaatgattatttcatgg
atttatttacctaccaattgtggggaagaaccctgtccaccgcttccctttaatcgttat
attgaaatatttaagaatagaaccttcatgaacttcacctttgtctctatttttctgtgg
gcacttcatacgcagttaaactttttacttcccttgagaggagaagctattctggataat
actaatattatcgggacaatatggaccattacaagtgtcaccgttattctcattcagcct
tttatttcacagatgtttttaaataaaatttccccaaaactctctatttgtattggttct
atattagtaggcagtggcgtgaccttgatcggttgggccaacagtttctattttttagtc
ttatgtgccattatttttatccttggagagatgtttatgatgcctactttagatagtgtc
actagcttgattgctgaccctaaaatgattggcgcttactttggtgtggcaaatttagcc
tcaggaattggagccgcctttggtacctttgctagcggaagactcattgatctctatggc
attaccgaatctgtactgccttgggttatgtacggcattgctaccgtagtcatcagtgga
ttaattttcttgcctgcaattaagacattagatcaaaataatgaaggtgctaaatga

DBGET integrated database retrieval system