KEGG   Alkaliphilus metalliredigens: Amet_4517Help
Entry
Amet_4517         CDS       T00551                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amt  Alkaliphilus metalliredigens
Brite
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Amet_4517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABR50589
UniProt: A6TWM1
LinkDB All DBs
Position
4619580..4620062
Genome map
AA seq 160 aa AA seqDB search
MHDMMLQPKMARAYIQGGPLAPQIRGVVYLIDVPAGTEVSVEVSGLPPFQPATNDKDPIG
PHGFHLHEFGTCEVSDPEDPFQAAGQHWNPRNEPHGNHAGDFPVLFSNNGKARMTFFTNK
FKVYEAIGTAVIIHENPDDYRSQPTGDAGRRLACGVIHWM
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacatgatgcttcaacctaaaatggctcgagcctatattcaaggaggcccgctg
gctccgcaaatcagaggggtggtgtacttaatagatgtacctgctggaactgaggtttca
gtggaagtatctgggctccccccttttcaaccagcgacaaatgataaggaccctattggt
ccacatggattccatcttcatgaatttggtacctgtgaggtgagtgatccagaagatccc
ttccaagctgctggccagcattggaacccgagaaacgaaccccatggaaatcatgccggt
gactttccagttttattttctaataatggtaaagcacgcatgaccttttttacaaataaa
tttaaagtatacgaagccattggaacagctgttatcatccatgaaaatcctgatgattac
cgctctcagcctacgggtgatgctggacggcgtctagcttgtggtgtgatccattggatg
taa

DBGET integrated database retrieval system