KEGG   Alkaliphilus metalliredigens: Amet_4643Help
Entry
Amet_4643         CDS       T00551                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00030  Pentose phosphate pathway
amt01100  Metabolic pathways
amt01120  Microbial metabolism in diverse environments
amt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amet_4643
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Amet_4643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABR50714
UniProt: A6TWZ6
LinkDB All DBs
Position
complement(4761294..4763105)
Genome map
AA seq 603 aa AA seqDB search
MYGYTGTILRINLKDKTVKKEALDLDLAKKFIGGRGLGEKILMDEIDPNIDALSPENKLI
VVTGPLSGTPTPTGGRYMVVTKSPLTGTAASSNSGGRWGAELKFAGYDLIIVEDKSETPV
YINIQDDVVTIKDAGHLWGKVVSQTTKMLNEELGDKVKVLTIGPGGEKLSRLAAIMNDLD
RAAGRSGVGAVMGSKNLKAITVRGTNKVAIHDPAKLKEVVSRVNKQIRENGVTGQGLPTY
GTAVLVNILNENGVFPTNNFQESVFAKAEDISGETLSDKYLVKRTGCYGCPIACGRHCKV
DDLESGGPEYETIWGFGADCGISDLGAIIKANYWCNEMGIDTISTATTIAAAMELYQKGL
IKDEELGGLSLEFGNADSIIEWTKRMGLREGLGDKMTDGSYRLCESYGAPEVSMSVKKQE
LPAYDPRGIQGQGLAYATSNRGGCHVRAYLISPEILGMPEKLDRFALEGKAQWVKIFQDL
TAVIDSMGLCLFTSFATSLQDYTDLYNAVTGETHTADTLLAAGERIWNTEKLFNLSAGIT
PAEDTLPERLLKDAIPGGPSAGNVAQLDKLLPEYYAVRGWDTEGIPTEARLEQLQIGLGT
TTA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtatacaggtacaattttgcgaattaacttaaaagacaagacagttaaaaag
gaagcattagatttagatttagcaaagaagtttattggaggaagaggtttaggggaaaag
attctgatggatgaaatcgatcccaacattgatgcactaagcccagaaaacaaactaatt
gttgtaacaggacccttaagtggaacgccaacacctactggtggaagatacatggtggtg
acaaaatctccattaactggaacggcagcttcttcaaactcaggtgggcgctggggagca
gagctaaaatttgctggatacgatttaattattgtagaagacaagtcagagactcctgtc
tatattaatattcaagatgatgtagtcacaattaaggatgcaggacatttatgggggaaa
gtcgtttctcaaacaaccaaaatgttaaacgaggagttaggagataaggttaaggttctg
accattggacctggtggagaaaaactttctcgtcttgcggcgatcatgaatgatctagat
cgtgcagctggaagatctggagtcggtgctgtcatgggctctaagaacctgaaggccatt
actgtaaggggcacaaataaagtagcaatacatgatccagctaagttgaaagaggttgtt
tcaagagtaaataagcagattagagaaaatggggttacgggtcagggactacctacctat
ggaaccgctgtacttgttaatatcttgaatgaaaatggtgtgtttccaactaacaatttc
caggaatctgtatttgctaaggcagaggacatcagtggagaaacattatcagataagtat
ttagtgaagcgaactggctgctatggatgtcctattgcctgtggcagacattgtaaagtg
gatgatctagaatctggtggaccagagtatgaaacaatctggggatttggagcagattgt
gggatttctgacctaggagccatcattaaagctaactattggtgtaatgaaatgggaatc
gataccatatccaccgccactaccatcgcggctgccatggaattataccaaaaaggtctc
attaaagacgaagagctaggtgggttgtctcttgagtttggcaatgcggattccattatc
gaatggacaaagcgcatgggattacgagaaggacttggtgataaaatgaccgatggttct
tatcgcttatgtgagagttatggggcgcctgaagtctccatgtcagttaaaaagcaggaa
cttccagcctatgacccgaggggaattcaagggcagggattagcctatgcaacttctaac
cgtgggggttgccatgtgagagcatatctaatttctcctgaaattttaggaatgcctgaa
aagctagaccgatttgcattggaaggaaaagcacaatgggtaaaaatattccaagactta
acagcggttattgattctatgggattatgtttatttacttcttttgcaacatcacttcaa
gattatacggatctttataatgcagtaacaggagaaacacatacagctgatacactattg
gcagctggagagcgcatatggaatacagaaaaactctttaatttgagtgcaggcatcaca
cctgccgaggatacgttgcctgagcgtttgctaaaggatgcaattcctggcggaccatct
gcagggaatgtggcgcagcttgataagctattgccggagtattatgctgtaagaggatgg
gatacagaaggtataccaactgaagcgcgtcttgaacagttgcagattgggttaggaaca
acaacagcataa

DBGET integrated database retrieval system