KEGG   Akkermansia muciniphila: Amuc_0661Help
Entry
Amuc_0661         CDS       T00736                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amu  Akkermansia muciniphila
Pathway
amu00473  D-Alanine metabolism
amu00550  Peptidoglycan biosynthesis
amu01100  Metabolic pathways
amu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Amuc_0661
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Amuc_0661
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Amuc_0661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amu01011]
    Amuc_0661
Enzymes [BR:amu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Amuc_0661
Peptidoglycan biosynthesis and degradation proteins [BR:amu01011]
 Precursor biosynthesis
  Amino acid ligase
   Amuc_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACD04498
UniProt: B2UPW3
LinkDB All DBs
Position
778178..779113
Genome map
AA seq 311 aa AA seqDB search
MNTLKRDLKIALLLGGPGAEREVSLVSGNSVYDALCRAGFTDVTKVDVHGPDFRLPEGTE
LAYNIIHGTFGEDGTLQAILEERGVPYTGAGSRSSALCFNKSESKKVFLEAGVPTPHAEI
LDCSNGIVMPSLPLPFVIKPPCEGSSVGVHIVRRQEDVLPAMEEAVTHGTTVLVEEFIQG
KELTVGILDGKALPVIHICPRSGFYDLSNKYPWMNMGGGTDYICPADLPEETAANVQEAA
LKAYKAAGVEVYGRVDVLLREEDGAPFVLEINTIPGMTPSSLLPKAAAASGWPYEDLCEK
IAELSLATPRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaacactctcaagcgcgacctcaaaatcgccctcctgctcggaggtcccggggcagaa
cgggaagtatcccttgtttccggcaactccgtttacgacgccctgtgccgggccggattc
accgatgtaacgaaggtggacgtgcacggcccggatttccggctgccggaaggcacggag
ctggcctacaacattatccacggcactttcggtgaggatggaaccctccaggccattctg
gaagaacgcggcgttccgtacacaggggccggctcccgttccagcgccctgtgcttcaac
aagtcagaatccaaaaaagtttttctggaagccggagttcctacgccgcatgcggaaatt
ctggactgttccaatggcatcgtgatgccgtccctccccctgcccttcgtcatcaagcct
ccctgcgagggttccagcgtgggcgtccacatcgtccgcaggcaggaggatgtgctcccc
gccatggaggaagccgtaacccacggcaccaccgtattggtggaagagttcattcaaggc
aaggaactgacggtcggcattctggacgggaaagcccttcccgttattcatatctgcccc
cgttccggcttctatgacctgagcaacaaatacccgtggatgaatatgggcggcggcacg
gattatatttgcccggcggatcttccggaagaaaccgccgccaacgtgcaggaggcggcc
ctgaaagcctacaaggccgccggcgtggaagtgtatggccgcgtggacgtactgctgcgc
gaggaagacggcgcccccttcgtgctggaaatcaacaccattcccggcatgaccccttcc
agcctgcttcccaaggcggcggcggcctccggatggccctatgaagacctctgcgaaaaa
atagcggaattatcgctagccaccccccgtaaataa

DBGET integrated database retrieval system