KEGG   Akkermansia muciniphila: Amuc_0730Help
Entry
Amuc_0730         CDS       T00736                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amu  Akkermansia muciniphila
Pathway
amu00473  D-Alanine metabolism
amu00550  Peptidoglycan biosynthesis
amu01100  Metabolic pathways
amu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Amuc_0730
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Amuc_0730
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Amuc_0730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amu01011]
    Amuc_0730
Enzymes [BR:amu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Amuc_0730
Peptidoglycan biosynthesis and degradation proteins [BR:amu01011]
 Precursor biosynthesis
  Amino acid ligase
   Amuc_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACD04567
UniProt: B2UQ32
LinkDB All DBs
Position
860791..861816
Genome map
AA seq 341 aa AA seqDB search
MFEIPDIQLNQYGKPARIMFLAPYAPDAPDFSKKPYTGNGGYPQYHYNIYKAIQDIGYDV
VSSSKPYSVQFAKGNVDYVFSLMNRFAMSRPEIFISSYCEFIQVPYLGAPPNIRAIAEDK
FLTKMVFRSLELNVPEGIGLSGEKGIPAQAPFPGPYFVKKRFGAASGGIREDSICSSWKA
VGSCARRLMEEGHEVLVEQYCEGIDVTVPVLGGENPVILGYVQPKSDKPGSIITEDLKLH
DHLGYQLVSVQDMEQDIASDVRKIWSALGPMDYFRIDYRIDFETGERRILEMNICCHLGK
SGSICLAAAEHGYSQADLLKYIIAYSMDRQKNLRQYGTWLI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaataccagacatccaactcaatcaatatggcaagccggcaaggatcatgttc
ctggctccatatgccccagacgctcccgatttctccaaaaaaccctacacaggcaatgga
ggctaccctcagtaccactacaacatttataaagccatccaggacataggctacgacgtc
gtctcctcctccaaaccctattccgtccaattcgccaagggaaacgtggactatgtattc
tccctgatgaacaggttcgccatgtccaggcctgaaatattcatttcttcttactgcgaa
ttcattcaggttccctacctgggcgccccgcccaacatccgcgccatagcggaagacaaa
tttctgaccaaaatggtattccgctccctggaattgaacgttccggaaggcattggactt
tccggagaaaaaggtattccggcccaggcccccttccctggcccctattttgtcaaaaag
cgttttggagccgcttccggcggcatccgggaagacagcatctgcagctcctggaaagcc
gtgggttcatgcgcccggcgcctgatggaagaagggcacgaagtgctcgtggaacaatac
tgtgaaggcattgacgtcaccgttcccgtactgggtggggaaaaccccgtcatcctggga
tatgtgcagccgaaatccgacaaaccaggcagcatcatcacggaagacctgaaactgcac
gaccatctgggttatcagctggtctccgttcaggatatggagcaggacatcgccagtgac
gtccggaaaatctggagcgctctggggccgatggactatttccgcatcgactatagaatc
gacttcgagacgggagaacggcgcattctggaaatgaacatctgctgccacctgggcaaa
agcggctccatctgcctggcggccgcagaacacggctactcccaggcggacctcctcaaa
tacattatcgcctacagcatggacaggcagaaaaacctccgccaatacggcacatggctc
atctga

DBGET integrated database retrieval system