KEGG   Akkermansia muciniphila: Amuc_1835Help
Entry
Amuc_1835         CDS       T00736                                 

Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
amu  Akkermansia muciniphila
Pathway
amu00511  Other glycan degradation
amu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Amuc_1835
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Amuc_1835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:amu02042]
    Amuc_1835
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Amuc_1835
Bacterial toxins [BR:amu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Amuc_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ACD05653
UniProt: B2UN42
LinkDB All DBs
Position
2229943..2231967
Genome map
AA seq 674 aa AA seqDB search
MGLGLLCALGLSIPSVLGKESFEQARRGKFTTLSTKYGLMSCRNGVAEIGGGGKSGEASL
RMFGGQDAELKLDLKDTPSREVRLSAWAERWTGQAPFEFSIVAIGPNGEKKIYDGKDIRT
GGFHTRIEASVPAGTRSLVFRLTSPENKGMKLDDLFLVPCIPMKVNPQVEMASSAYPVMV
RIPCSPVLSLNVRTDGCLNPQFLTAVNLDFTGTTKLSDIESVAVIRGEEAPIIHHGEEPF
PKDSSQVLGTVKLAGSARPQISVKGKMELEPGDNYLWACVTMKEGASLDGRVVVRPASVV
AGNKPVRVANAAPVAQRIGVAVVRHGDFKSKFYRIPGLARSRKGTLLAVYDIRYNHSGDL
PANIDVGVSRSTDGGRTWSDVKIAIDDSKIDPSLGATRGVGDPAILVDEKTGRIWVAAIW
SHRHSIWGSKSGDNSPEACGQLVLAYSDDDGLTWSSPINITEQTKNKDWRILFNGPGNGI
CMKDGTLVFAAQYWDGKGVPWSTIVYSKDRGKTWHCGTGVNQQTTEAQVIELEDGSVMIN
ARCNWGGSRIVGVTKDLGQTWEKHPTNRTAQLKEPVCQGSLLAVDGVPGAGRVVLFSNPN
TTSGRSHMTLKASTNDAGSWPEDKWLLYDARKGWGYSCLAPVDKNHVGVLYESQGALNFL
KIPYKDVLNAKNAR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggggcttggcctgttgtgcgcactgggcctgtctattccctccgttctcggcaaggaa
agctttgagcaggccaggcgtggcaaatttacaacgctttccaccaaatacggccttatg
tcctgccggaacggtgtggcggaaatcggaggagggggaaaatccggagaagcctccctg
cggatgttcggcggacaggatgctgaattgaaactggacttgaaggatacgccttccagg
gaagtccggctttctgcctgggcggagcgatggaccgggcaggccccttttgaattttcc
attgtggccatagggccgaatggagaaaagaaaatttatgacggcaaggatatcaggacg
ggcgggtttcataccaggatagaagccagtgttcctgccggaacgcgttccctggtgttc
aggcttacttctccggaaaacaagggaatgaagctggacgacctgtttcttgttccctgt
attcccatgaaagtgaatccgcaggtggagatggcctcttccgcttacccggtgatggtg
cgtatcccgtgcagccccgttctttctctgaatgtccggacggacggctgccttaatcct
cagttcctgacagctgtcaatctggattttacgggtacgacgaagctttccgacattgag
tccgtggctgtaatacggggggaagaggcccctatcatccatcatggggaagagccgttc
ccgaaagactcttcccaggttcttggtacagtaaagcttgccggttccgccagaccccag
atttctgtgaaggggaaaatggagctggagcccggagacaattacctgtgggcttgcgtg
acgatgaaagaaggagcctccctggacggcagggtggtggtgcgtccggccagcgttgtg
gcgggcaataaaccggtgagggttgccaatgcggctcccgtggcgcagcgcatcggcgtg
gccgtagtcaggcatggggatttcaaatcaaaattctaccgtattcccggtctggcccgt
tccaggaaggggaccctgctggccgtgtacgatatccggtacaaccattccggagacctt
ccggccaacattgatgtgggcgtaagccgctctacggacggaggccgcacctggtctgat
gtcaaaatcgccattgatgattccaagattgacccctctctgggggctaccaggggcgta
ggggatccggccattctggtggatgaaaagacggggcgcatctgggtggccgccatatgg
agccacaggcattccatctggggcagcaagtccggagacaattctccggaggcctgcgga
cagctggtgctggcctacagcgatgacgatggcctgacctggtccagtccgatcaatatc
acggaacaaaccaagaacaaggattggcgcattttatttaatggccccggcaatggcatt
tgcatgaaagacggcacgctggtcttcgccgcccagtactgggacggcaaaggggtgccg
tggtccaccattgtttattccaaagaccggggaaaaacctggcactgcggcacgggcgtc
aaccagcagacgacggaagcccaggtgattgagctggaagacggctccgtcatgatcaac
gcccgatgcaactggggcggttcccgcatcgtgggcgttacgaaagacctgggccaaacg
tgggaaaaacaccccaccaaccgcactgcccagctgaaggaaccggtctgccagggcagc
ctgcttgccgtggacggcgttccgggcgcgggcagagtggttctgttttccaatcccaat
accacatccggacgttcccacatgacgttgaaagcttctacgaatgatgccgggtcatgg
ccggaagacaaatggcttctttatgatgcccgcaaaggctggggatattcctgcctggcg
ccggtagataagaaccatgtgggcgtgctgtacgaatcccagggggcgctgaacttcctg
aaaattccctataaggatgttcttaacgcaaaaaatgcgcgctga

DBGET integrated database retrieval system