KEGG   Acidiphilium multivorum: ACMV_08240Help
Entry
ACMV_08240        CDS       T01446                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
amv  Acidiphilium multivorum
Pathway
amv00630  Glyoxylate and dicarboxylate metabolism
amv00710  Carbon fixation in photosynthetic organisms
amv01100  Metabolic pathways
amv01120  Microbial metabolism in diverse environments
amv01200  Carbon metabolism
Module
amv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
amv_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_08240 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_08240 (rbcL)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ACMV_08240 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF2721
Motif
Other DBs
NCBI-ProteinID: BAJ80171
NITE: ACMV_08240
UniProt: F0J5C2
LinkDB All DBs
Position
complement(931792..933057)
Genome map
AA seq 421 aa AA seqDB search
MSGAERIEADYLIETAFDPGHAAAAMAGEQSSGTFVPVPGETPELKARAAARVERLDVLE
TVGSPSLPGAGTPRGASPPVIRRAAVTLSWPVDNLGPSLPNLVATVAGNLFELRQFSGLR
LLDLRLPASFAAANPGVRFGIPGTRRLAGVEGRPLIGTIVKPSVGFDAGQTAALVATLCE
AGIDFIKDDELQADGPACPFEARARAVMRVVNDHAERTGKKVMFAFNLTGEVDEMRRRHD
LVRELGGTCVMASLNSVGVSGFLALSRHAALPVHAHRNGWGALSRHPLLGWSYVAWQKIW
RLAGADHMHVNGLRNKFSEDDDSVIASARACLTPMSDAAPNVVMPVFSSGQSVRQAGDTY
AALGSADLIYAAGGGIMGHPGGPAEGVAALRAAWDAAMAGIPAAEHAKTHPALARALEGA
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcgcggaacgcatcgaagccgattacctgatcgagaccgcgttcgaccccggc
cacgccgccgcggcgatggccggcgagcagtcgagcggcaccttcgtgccggtgcccggc
gaaacccccgaactcaaggcgcgcgccgcggcacgggtcgagcggctcgatgtcctggaa
acggtcggctcgccctccctgcccggcgccggaaccccgcgcggcgcgtcgccgccggtc
atccgccgcgccgccgtcaccctttcctggccggtggacaatctcggcccgtcgctgccc
aatctcgtcgcgaccgtcgccggcaatctcttcgaactgcgccagttctccggcctgcgc
ctgctcgacctgcggctgcccgcgagcttcgccgccgccaatcccggcgtgcgcttcggc
atccccggcacgcggcggcttgccggcgtcgaggggcggccgctgatcggcaccatcgtc
aagcccagcgtcggcttcgatgccgggcagaccgcggcgctggtcgccaccctctgcgag
gccggcatcgacttcatcaaggacgacgagttgcaggccgacggccccgcctgcccgttc
gaggcccgcgcccgcgcggtgatgcgcgtcgtcaacgatcatgccgagcgaaccggaaag
aaggtgatgttcgccttcaacctgaccggcgaggtcgacgagatgcgccgccggcacgac
ctcgtgcgcgagctcggcggcacctgcgtgatggcgagcctcaattccgtgggcgtcagc
ggcttcctcgcgctgtcgcgccacgccgcgctgccggtccacgcgcatcgcaacggctgg
ggcgcgctgtcgcggcacccgctgctgggctggtcctatgtcgcctggcagaagatctgg
cgcctcgccggcgccgaccacatgcatgtgaacggcctgcgcaacaagttctccgaggat
gacgacagcgtcatcgcctccgcgcgcgcctgtctcaccccgatgtccgacgcggcgccg
aacgtcgtcatgccggtcttctcctccggccagtcggtccgccaggcgggcgacacctac
gcggcgctcggctcggccgacctgatctacgccgccggcggcggcatcatgggccatccc
ggcgggccggccgaaggcgtggcggccttgcgcgcggcgtgggacgcggcgatggcgggc
attcccgccgccgagcacgcgaagacgcacccggcgctggcccgggcgctggagggcgcg
tcctga

DBGET integrated database retrieval system