KEGG   Acidiphilium multivorum: ACMV_12610Help
Entry
ACMV_12610        CDS       T01446                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00030  Pentose phosphate pathway
amv00710  Carbon fixation in photosynthetic organisms
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
amv01230  Biosynthesis of amino acids
Module
amv_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
amv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amv_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
amv_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACMV_12610 (tkt)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_12610 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ACMV_12610 (tkt)
Enzymes [BR:amv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ACMV_12610 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: BAJ80608
NITE: ACMV_12610
UniProt: F0IXU8
LinkDB All DBs
Position
1422762..1424795
Genome map
AA seq 677 aa AA seqDB search
MASSDTAGNEIALERQKAVLARPMTETRRLANAVRALAIDGVEAAKSGHPGMPMGMADVA
TVLWTKFMKFDAADPHWPDRDRFILSAGHGSMLLYALLHLTGYEGMSIDDLRQFRQLGAR
AAGHPERIEHPAIEMTTGPLGQGISTATGFALAERMLAARFGKGLVDHRTWVIASDGDMM
EGVSHEACAIAGHLGLDKLTVFYDDNSISIDGGTDIAMTDDVLKRFAGYGWATRRIDGHD
PEQIESAIRFALRSRKPTLIACRTIIGFGAPKKAGTPATHGSPLGADEAAAAKALLGWTA
PPFTVPDDILAPWRAAGSRSAGAHRAWTKRHAASNQRAAFDAALAGDLPADYTAAMAALR
EKIAAEKPNVATRQASQMALDAVVPVVPEMVGGSADLTPSNNTFVKSMGVFTAKDHAGRY
IHFGVREHGMGTTLNGLALHGGLIPYGGTFFIFSDYCRPAIRLAALMRIRSIFVLTHDSI
GLGEDGPTHQPVEHLASFRAMPNVLVLRPGDAMETAECWDIALKHKDGPVLLVLSRQAMP
TLPRDHGAENLSARGGYVVAPAAGPRRATILATGSEVALALKAREMLAAEGITVAVASVP
SFELLERQDPGYRTEVLGEAPRVGVEAAVGFGWERLLGPDGTFIGMHGFGASAPYQKLFQ
HFGITAEAVVAAVKAKL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggccagtagcgacaccgccggcaacgagattgcgctggagcgccagaaggcggtcctc
gcccgcccgatgaccgagacccgccggcttgccaacgccgtccgcgcgctcgcgatcgac
ggcgtcgaggccgcgaagtccggccatcccggcatgccgatgggcatggccgatgtcgcg
acggtgctgtggacgaagttcatgaagttcgacgcggccgatccccactggcccgaccgc
gaccgcttcatcctctccgccggccacggctcgatgctgctctacgcgctgctgcacctc
accggctacgagggcatgtcgatcgacgatctgcgccagttccgccagctcggcgcccgc
gccgccggccatcccgagcggatcgagcatcccgccatcgaaatgaccaccggcccgctc
ggccagggcatctcgacggcgaccggcttcgccctcgccgagcgcatgctcgccgcccgc
ttcggcaagggcctggtcgatcaccgcacctgggtcatcgcctcggatggcgacatgatg
gagggcgtgtcccacgaggcctgcgccatcgccggccatctcggcctcgacaagctcacc
gtcttctacgacgacaactcgatctcgatcgacggcggcaccgacatcgcgatgaccgac
gacgtgctgaagcgcttcgccggctatggctgggccacccgccggatcgacgggcacgac
cccgagcagatcgaatccgccatccgcttcgccctgcgcagccgcaagccgacgctgatc
gcctgccgcaccatcatcggcttcggcgcgccgaaaaaggccggcaccccggccacccac
ggctcgcccctcggcgccgacgaggccgccgccgccaaggccctgctcggctggaccgcc
ccgcccttcaccgtgccggacgacatcctcgccccctggcgcgcggccggatcgcgcagc
gccggcgcccaccgcgcctggacgaagcgccacgccgccagcaaccagcgcgccgccttc
gatgccgccctcgccggcgacctgccggccgactacaccgccgcgatggccgccctgcgc
gagaagatcgccgccgagaagcccaacgtcgccacccgccaggccagccagatggcgctc
gacgccgtggtgcccgtggtccccgaaatggtcggcggctccgccgacctcaccccctcg
aacaacaccttcgtgaagtcgatgggcgtattcacggcgaaggaccacgccggccgctac
atccatttcggcgtgcgcgagcacggcatgggcacgacgctgaacggcctcgccctgcat
ggcgggctgatcccctatggcggcacgttcttcatcttctccgactattgccgccccgcc
atccgcctcgccgcgctgatgcgcatccgctcgatcttcgtgctcacccacgattcgatc
ggcctcggcgaggacgggccgacccaccagccggtcgagcacctcgcctcgttccgcgcc
atgcccaacgtcctcgtgctgcgccccggcgacgcgatggagaccgccgaatgctgggac
atcgcgctgaagcacaaggacggcccggtcctgctcgtgctcagccgccaggcgatgccg
accctgccgcgcgaccacggcgctgaaaacctctccgcccgcggcggctatgtcgtcgcc
ccggccgcggggccgcgccgcgccaccatcctcgccaccggctcggaagtcgccctcgcg
ctcaaggcgcgcgagatgctggcggcggagggaatcaccgtcgccgtcgcctcggtgccg
agcttcgaactgctcgaacgccaggaccccggctaccgcaccgaggtgctgggcgaggct
ccgcgcgtcggcgtcgaggccgcggtcggcttcggctgggaacgcctgctcgggccggac
ggcaccttcatcggcatgcacggcttcggcgccagcgcgccctaccagaagctgttccag
catttcggcatcaccgccgaggcggtcgttgcggcggtgaaggcgaagctgtaa

DBGET integrated database retrieval system