KEGG   Acidiphilium multivorum: ACMV_16680Help
Entry
ACMV_16680        CDS       T01446                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
amv  Acidiphilium multivorum
Pathway
amv00020  Citrate cycle (TCA cycle)
amv00310  Lysine degradation
amv00380  Tryptophan metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACMV_16680 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ACMV_16680 (sucA)
   00380 Tryptophan metabolism
    ACMV_16680 (sucA)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ACMV_16680 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II COQ9
Motif
Other DBs
NCBI-ProteinID: BAJ81015
NITE: ACMV_16680
UniProt: F0IZ05
LinkDB All DBs
Position
complement(1863872..1866721)
Genome map
AA seq 949 aa AA seqDB search
MAGVDILATAMNGGNAAFIANLYAKWVEAPDSVDPDFASLFAALGDDARSVLGDAAGASW
APRPISFERPAAPAEAGKGAPLSRQGTIDSIRALMFIRAYRVRGHLEADLDPLGLRQPGH
HPELDPASYGFTEADMDRPIFIDMVLGRETATMREIIAILRESYCGKIGVEFMHIQDPEQ
KSWIQRRVEGAPWRTALDKEGKRRVLTQLTEAEGFETFCQRRYVGTKRFGLEGGESTIPA
LHAIIETAARAGVNEIAIGMPHRGRLNTLVNIVKKPFTAVFSEFGGESFKPDAVQGSGDV
KYHLGTSADLVIAGNKVHLSLQPNPSHLEAVDPVVAGKVRARQDMAGDTRGRRSVMGILM
HGDAAFAGQGLVYETLAMSQLIGYRTGGTVHIVVNNQIGFTTVPAHAYSGLYCTDVAKSV
QSPIFHVNGDDPEAVVFVAQLATEFRQEFGVDVVIDLVCYRRHGHNETDEPAFTQPLMYQ
AIRGRKTTRTLYAERLAAEGAVGTAESDQIHKDFVATLEEAYKAAASYKPNKADWLEGHW
AGLNSARDEEGETEEPTAIPLDTLRRIGNALARVPDDFDVNPKIARQLEAKAEMIRTGEG
IDWATGEALAFGSLLLEGHRVRLSGEDCQRGTFSQRHAVLIDQTSQNEYVPLNNIGEEQS
RIEIFNSLLSEAGVLGFEYGYSLADPRTLVLWEGQFGDFANGAQVIIDQFIAAGESKWLR
MSGLTLLLPHGYEGQGPEHSSARPERFLQLCAENNMAVCNITTPANYFHALRRQLKRNFR
KPLIIMTPKSLLRHKLAVSTLEDMTNGSAFRTVIPETDALVAPEKVRRVVLCSGKVYYDL
VAERRDRGIDDVAIVRVEQLYPFPKKALKTAIEAYVNAEVIWCQEEPENMGYWHFLDRRI
EAALECTATKMAASRPRFAGRKAAASPATGLAKVHAAEQAALVREALGV
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgtggatattcttgcgacggcgatgaatggcggcaacgcggcgttcatcgcc
aacctctatgcgaaatgggtcgaggcgcccgattcggtcgatccggatttcgccagcctg
ttcgccgcactgggcgacgatgcgcgatcggtgctgggcgatgcggccggtgcctcctgg
gcgccgcgaccgatcagcttcgaacgaccggccgcgccggccgaggcgggcaagggcgcg
ccgctttccagacagggcacgatcgattcgatccgtgccctgatgttcatccgggcctat
cgcgtgcgcggccatctggaggccgatctcgatccgctcggcctgcgccagcccggccac
cacccggaactcgacccggccagctacggcttcaccgaggccgacatggaccggccgatc
ttcatcgacatggtgctgggccgcgagaccgcgacgatgcgcgagatcatcgccatcctg
cgcgagagctattgcggcaagatcggcgtcgagttcatgcacatccaggaccccgagcag
aaatcctggatccagcgccgcgtcgagggcgcgccctggcgcaccgcgctcgacaaggag
ggcaagcgccgcgtcctcacccagctcaccgaggccgagggcttcgagaccttctgccag
cgccgctatgtcggcaccaagcgcttcgggctggagggcggcgaaagcaccatccccgcg
ctgcacgcgatcatcgagacggcggcgcgggccggcgtcaacgagatcgcgatcggcatg
ccgcatcgcggccggctcaacacgctggtcaacatcgtcaagaagccgttcaccgcggtg
ttctccgaattcggcggcgagagcttcaagccggacgcggtgcagggctcgggcgacgtc
aaataccatctcggcacctcggccgacctcgtcatcgccggcaacaaggtgcatctctcg
ctgcagcccaacccctcgcatctcgaggcggtggatccggtcgtcgccggcaaggtccgc
gcccggcaggacatggcgggcgacacccgcggccgccgctcggtcatgggcatcctgatg
catggcgacgccgccttcgccggccagggcctcgtctatgaaaccctggcgatgagccag
ctgatcggctaccgcaccggcggcacggtccatatcgtggtgaacaaccagatcggcttc
accaccgtgcccgcccacgcctattccggcctctactgcaccgatgtcgccaaatccgtg
cagtcgcccattttccatgtgaacggcgacgatcccgaggcggtggtcttcgtcgcccag
ctcgcgaccgagttccgccaggaattcggcgtcgacgtggtgatcgacctggtctgctac
cgccgccacggccataacgagaccgacgagccggccttcacccagccgctgatgtaccag
gcgatccgcggccgcaagacgacccgcaccctctatgccgagcgcctcgccgccgagggc
gcggtcggcaccgccgagtccgaccagatccacaaggatttcgtcgccacgctggaagag
gcctacaaggccgccgccagctacaagccgaacaaggcggactggctggaaggccactgg
gccggcctcaactccgcgcgcgacgaggagggcgagactgaggaacccaccgccatcccg
ctggacacgctgcgccggatcggcaacgcgctggcccgcgttcccgacgatttcgacgtc
aaccccaagatcgcccgccagctcgaggccaaggccgagatgatccgcaccggcgagggg
atcgactgggcgaccggcgaggcgctcgccttcggctcgctcctgctcgagggccatcgc
gtccgcctctccggcgaggactgccagcgcggcacgttcagccagcgccacgccgtgctg
atcgaccagaccagccagaacgaatacgtcccgctcaacaatatcggcgaagagcagtcc
cgcatcgagatcttcaactcgctgctctccgaggccggcgtgctcggcttcgaatacggc
tattcgctggccgacccgcgcaccctcgtgctctgggaaggccagttcggcgacttcgcc
aacggcgcgcaggtcatcatcgaccagttcatcgccgccggcgagagcaagtggctgcgc
atgtccggcctgaccctgctgctgccgcacggctatgaagggcaggggccggaacattcc
tcggcccgccccgagcgcttcctgcagctctgcgccgagaacaacatggcggtttgcaac
atcaccaccccggccaactatttccacgcgctgcgccgccagctgaagcggaacttccgc
aagccgctgatcatcatgacgccgaaatcgctgctgcggcacaagctcgcggtctcgacg
ctggaggacatgaccaacggctcggccttccgcaccgtgatccccgagaccgatgcgctg
gtcgcccccgagaaggtccgccgcgtcgtgctctgctcgggcaaggtctattacgacctg
gtcgccgagcggcgcgaccgcgggatcgacgatgtcgcgatcgtgcgggtcgagcagctc
taccccttcccgaagaaggcgttgaagaccgcgatcgaggcctatgtgaacgccgaggtg
atctggtgccaggaggagcccgagaacatgggctactggcatttccttgaccgccggatc
gaggcggcgctggaatgcaccgcgacgaagatggccgcctcgcgcccgcgcttcgccggc
cgcaaggccgcggcgagcccggcgacggggcttgcgaaggttcacgccgccgaacaggcg
gccctggtcagggaagcgctcggcgtctga

DBGET integrated database retrieval system