KEGG   Acidiphilium multivorum: ACMV_23190Help
Entry
ACMV_23190        CDS       T01446                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
amv  Acidiphilium multivorum
Pathway
amv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:amv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_23190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amv02000]
    ACMV_23190
Transporters [BR:amv02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    ACMV_23190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_16 AAA_5 AAA_29 Mg_chelatase AAA_33 AAA_23 AAA_24 NACHT ATP-synt_ab MobB DUF87 AAA_18
Motif
Other DBs
NCBI-ProteinID: BAJ81666
NITE: ACMV_23190
UniProt: F0J0Y0
LinkDB All DBs
Position
complement(2564388..2566418)
Genome map
AA seq 676 aa AA seqDB search
MSAVLAGTERDGATAATPALAVEGLEVAYRTRGQELAVLRGVSFSIAPGESFGLVGESGC
GKSTAALAALGALPRNGRVRAGSIRIGGEDLARLDAGALRRLRARRVSMVYQDASRALNP
ALTIGVQLREAFELLGIAGAAAGARSREALDQVRIAAPGRVLAAYPHELSGGMLQRVVIA
MALAKDPALLVLDEPTTALDATVEAEVLDLIATLRAVHGTSVLFISHNLGVIEQMCDRIG
VLYAGSLVEQGGAARLLERPLHPYTIRLLRCLPAPGRNKVTSRLDTIPGFLPPPGAMVPG
CVFAPRCDLADQTCRTRPPPPHREGEQTTRCHHWQRAGTLADAPAAALAPPEAAPAETVL
RAENLSKTFAIGGRALRALGEVSLTLGRGETLGIVGESGSGKTTLARLLLGLVRPDAASR
VELAGELAAPEAAGRSDAQRKALQIVFQNPDSALNRAHSVRHLIGRALRRLAGLAPGQAE
ARLAELVAAVRLTERHLAMRPRQLSGGLKQRVAIARAFAGEPRVIICDEPTSALDVSVQA
AILNLLADLQRERQVSYIFISHDLGVVRYISDRIAVLYLGRIMELGPAEAVFSGPHHPYT
EALLSAVATPGGRSGRIRLAGEIPSPLNPPQGCAFHTRCPRKLGAVCETTEPALETIGDH
AIRCHIPRDALGRRGA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtgctggccggcacggagcgggacggcgccaccgcggcgaccccggccctg
gcggtggaggggctcgaggtcgcctatcgcacgcgggggcaggaactcgcggtgctgcgc
ggcgtgtcgttctcgatcgcgccgggggagtcgttcggcctggtcggcgaatcggggtgc
ggcaagtcgaccgcggcgctggccgccctcggcgcgctgccgcgcaacgggcgggtgcgg
gcgggcagcatccgcatcggcggcgaggatctcgcccgcctcgacgccggagcgctgcgg
cggctcagggcgcgccgggtctcgatggtgtatcaggacgcgagccgcgcgctgaacccg
gcgctgaccatcggggtgcagctgcgcgaggcgttcgagctgctcggcatcgccggggcg
gcggccggggcgcgctcgcgcgaggcgctcgaccaggtgcggatcgcagcgccggggcgg
gtgcttgccgcctatccgcacgagctctcgggcgggatgctgcagcgggtggtgatcgcc
atggcgctggcgaaggacccggcgctgctggtgctcgacgagccgaccacggcgctcgac
gccacggtcgaggccgaggtgctcgacctgatcgccacgctgcgggcggtgcacggcacc
tcggtgctgttcatcagccacaatctcggcgtgatcgagcagatgtgcgaccggatcggc
gtgctctatgccggcagcctggtggagcagggcggtgccgcgcggctgctggagcggccg
ctgcatccctacacgatccggctgctgcgctgcctgccggcgccggggcggaacaaggtg
acgtcgcggctcgacacgattcccggcttcctgccgccgccgggggcgatggttcccggc
tgcgtgttcgcgccgcgctgcgacctggccgatcagacctgccggacccgcccgccgccg
ccgcaccgcgagggggagcagacgacgcgctgccatcactggcaacgcgcgggcacgctg
gcggacgcgcccgccgccgcactggcgccgccggaggccgccccggcggagaccgtgctg
cgggcggagaatctttccaagaccttcgcgatcggcgggcgggcgctgcgcgcgctcggc
gaggtgtcgctcacgctcgggcggggggagacgctcggcatcgtcggcgagagcggcagc
ggcaagacgacgctggcgcggctgctgctcggcctcgtccgcccggatgcggcgagccgg
gtggagcttgccggggaactcgccgcgccggaggcggcggggcggagcgatgcccagcgc
aaggcgttgcagatcgtcttccagaacccggattcggcgctgaaccgcgcgcacagcgtg
cgccacctgatcggccgggcgctgcggcggctggcggggctggcgccggggcaggccgag
gcgcgactcgccgagctggtggcggcggtgcggctgaccgagcggcatctcgcgatgcgg
ccgcgccagctttcgggcgggctgaagcagcgcgtcgccatcgcccgcgcctttgccggc
gagccgcgcgtgatcatctgcgacgagccgacctcggccctcgacgtctcggtgcaggcg
gcgatcctcaacctgctcgccgacctgcagcgcgagcggcaggtgagctacatcttcatc
tcgcacgatctcggcgtggtccgttacatctccgaccggatcgcggtgctctatctcggg
cggatcatggaactcggcccggcggaggcggtgttttccggcccgcaccacccctatacc
gaggcgctgctctcggcggtggcgaccccgggcgggcgcagcgggcggatccggctcgcg
ggcgagatcccgagcccgctcaacccgccgcagggctgcgcgttccacacccgctgcccg
cgcaagctcggcgcggtgtgcgagacgacggagccggcgctggagacgatcggcgatcac
gcgatccgctgccacatcccgcgcgacgcgctggggcggcgcggggcgtag

DBGET integrated database retrieval system