KEGG   Acidiphilium multivorum: ACMV_27120Help
Entry
ACMV_27120        CDS       T01446                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amv  Acidiphilium multivorum
Pathway
amv00564  Glycerophospholipid metabolism
amv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACMV_27120 (glpD)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACMV_27120 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAJ82059
NITE: ACMV_27120
UniProt: F0J3B3
LinkDB All DBs
Position
complement(2980444..2981961)
Genome map
AA seq 505 aa AA seqDB search
MVHDIAIIGGGINGCGIARDAAGRGWSVFLCEAGDLGGATSAASTKLIHGGLRYLEYYEF
RLVREALMEREVLWGIAPHIIWPLRFVLPHHKGLRPAWMLRLGLFLYDHLGGRKKLPPTR
VVRLRRDPAGRPLDPRFVRAYEYSDCWVEDSRLVVLNARDAADRGAVIEPRTRCISGARE
GGLWTLTVRDERSGETRTVRARALVNAAGPWVAEVLQKVLRANTPASVRAVQGSHIVVPR
LYPEDHCYIFQNADGRIFFVIPYERDFTLIGTTDRDYQGDPAEVRASADEIAYLCESASA
YFTKPVTPADVVWAYSGVRPLYDDGASKAQAATRDYVLEMDAPADGPALLSVFGGKITTY
RRLAESVLGKLAPHLPPATARKQGWTGDEPLPGGDFPTDGFDAQVAALLRDYPFLAPATA
ARLVRAYGTRARVLLGDARRAEDLGAIFGADLTEAELRYLHAHEFALTAEDVVWHRSKFG
LRLSDAEIAAVERFMQTLAAQDAHA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggtccacgacatcgcgatcatcggcggtggcatcaatggctgcggcatcgcgcgcgat
gcggcggggcgcggctggtcggtctttctctgcgaggcgggcgatctcggcggcgccacc
tcggcggcctcgaccaaattgatccatggcggcctgcgctatctcgaatattacgagttc
cggctggtgcgcgaggcgctgatggagcgcgaggtgctgtggggcatcgcgccgcacatc
atctggccgttgcgcttcgtgctgccgcaccacaaggggttgcgcccggcctggatgctg
cggctcggcctctttctctacgatcatctcggcgggcggaagaaactgccgccgacgcgc
gtggtgcggttgcggcgcgatcccgccggccgcccgctcgatccgcgctttgtccgcgcc
tacgaatattcggattgctgggtggaggattcgcgcctcgtcgtgctgaacgcgcgcgat
gcggcggatcggggcgcggtgatcgagccgcgcacccgctgcatcagcggcgcgcgcgag
ggcgggctgtggaccctcaccgtgcgcgacgagcgcagcggcgaaacccgcacggtgcgc
gcccgcgccctggtgaacgccgccgggccctgggtcgccgaggtgctgcagaaggtgctg
cgggcgaacacgccggcctcggtgcgcgccgtccagggcagccacatcgtcgttccccgg
ctctaccccgaggatcattgctacatcttccagaacgccgatggccgcatcttcttcgtc
atcccctatgagcgggatttcaccctgatcggcaccaccgatcgcgactatcagggcgac
cccgccgaggtgcgtgcctcggctgacgagatcgcctatctctgcgaatccgccagcgcc
tatttcacgaagccggtcacgccggcagatgtcgtctgggcctattccggcgtccgcccg
ctctatgacgacggcgcctcgaaagcccaggccgccacgcgcgactacgtgctggagatg
gacgccccggccgatggccccgccctgctctcagtctttggcggcaagatcacgacctac
cgccgcctggccgaatcggtgctcggcaagctcgcgccgcacctgccgcccgccaccgcg
cggaagcagggctggaccggcgacgagcccctgcccggcggcgacttcccgaccgacggg
ttcgacgcccaggtggcggcgctgttgcgcgactatccgttcctcgcgccggccaccgcg
gcgcggctggtcagggcctatggcacccgcgcgcgcgtcctgctcggcgatgcgcggcgg
gcggaggatctcggcgccatcttcggcgccgacctgaccgaggcggaactgcgttacctg
cacgcccacgaattcgcgctgaccgcggaggacgtggtctggcaccgcagcaagttcggc
ctgcggctgagcgatgccgagatcgccgctgtcgagcggttcatgcagaccctcgccgca
caggacgcccacgcatga

DBGET integrated database retrieval system