KEGG   Acidiphilium multivorum: ACMV_31590Help
Entry
ACMV_31590        CDS       T01446                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amv  Acidiphilium multivorum
Pathway
amv00010  Glycolysis / Gluconeogenesis
amv00020  Citrate cycle (TCA cycle)
amv00620  Pyruvate metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACMV_31590 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ACMV_31590 (pdhC)
   00620 Pyruvate metabolism
    ACMV_31590 (pdhC)
Enzymes [BR:amv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ACMV_31590 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: BAJ82506
NITE: ACMV_31590
UniProt: F0J5W2
LinkDB All DBs
Position
3441255..3442541
Genome map
AA seq 428 aa AA seqDB search
MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL
VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAPAAET
TGHGPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSAPEAAAPAPKAPA
AAPPAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKLR
AELNAQSPKEGPGAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVAVAI
PDGLITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGISSFS
AIINPPQGGILAIGAGEKRPVVKGEQIAIATVMTVTLSCDHRVVDGAVGAEFLAAFKSIV
EQPLGLML
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaacatcctgatgccggcactctcgcccaccatgacggaaggcacgctggcg
cgctggctcaagaaggaaggcgagacgatcaaggccggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaggtcgaggcggtcgacgagggcgttctcggcaagatcctg
gtcgctgccggatcggagaatgtcgcggtgaacgcgccgatcgccattctcgtcgaaccg
ggcgaagccgtgccggacagcgcgcccgctgccccggcgccaaagcccgccgccgcgccg
gaaccggtggcggcacctgccccggctgcggcagctccggccgcgccggcggcggagacg
accgggcatggcccgcgcgtcttcgcttcgccgctcgcccgccgcatggcgcagcaggcg
gggatcgacctcgccacgctcaagggctccggcccgaacgggcggatcgtcaaggcggat
atcgacgccgcccgcggcagtgccccggaagccgcggcaccggcgccgaaagcgccagct
gccgccccaccggcgcaagccgccgcggccccggccgcgccgatcaccgcgccgcatgac
gcgatcccgcattcctcgatgcgcaaggtgatcgcgaagcggttgcaggccgcgaaacag
accattccgcatttctatctgtcgatggatgtcgagctcgacgcgctgctcaagctgcgc
gccgagctgaacgcgcaatcccccaaggaggggccgggcgcgttcaagctttcggtcaac
gacctgatcatcaaggcggtcgccgtcgccctgcgccgcgttccggcggccaacgcctcg
ttcaccgaggaggcgatgatccgttatcacgacgtggacatctcggtggccgtcgcgatt
ccggacgggctgatcacgccgatcatccgcaaggcggaccagaaaggcctggccgcgatc
agcaacgagatgaaggatctcgccgcgcgggcaaaggccggcaagctgaagccggacgaa
ttccagggcggatcgttctcgatctccaatcttggcatgtatggcatcagctcgttctcg
gcgatcatcaacccgccgcagggcggcattctcgccatcggcgccggcgagaagcggccg
gtggtgaagggtgagcagatcgccatcgccacggtgatgaccgtcaccctgtcctgcgac
catcgcgtggtggatggcgcggtcggcgccgaattcctcgcggcgttcaagtccatcgtc
gaacagccgctggggctgatgctttga

DBGET integrated database retrieval system