KEGG   Acidiphilium multivorum: ACMV_32110Help
Entry
ACMV_32110        CDS       T01446                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00473  D-Alanine metabolism
amv01100  Metabolic pathways
amv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACMV_32110 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ACMV_32110 (alr)
Enzymes [BR:amv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ACMV_32110 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:amv01011]
 Precursor biosynthesis
  Racemase
   ACMV_32110 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAJ82558
NITE: ACMV_32110
UniProt: F0J6E1
LinkDB All DBs
Position
complement(3492082..3493155)
Genome map
AA seq 357 aa AA seqDB search
MNHPTLTIDPGAVAANWQALAARHAGEVAGVVKADAYGLGAALIAPALAAAGCRSFFVAT
LDEALSLRALLPAARIGVLNGCPPGEEETMRARELRPVLGSLAACARWRGAAGDDEAPPS
FLHLDTGMNRLGLDRDEAAHLIAHPTLLDGLGLTHVMTHLVAAEEPDASANAAQRERFAA
FAARFPWLRTSLANSSGLFLGPGFGSDLARPGYALYGGNPTPTAANPMRPAIALAAPILQ
IRAIASGETVGYNGTWRAARPSRIATIGVGYADGLPRSLSNRLTARWQGKIIPVAGRLSM
DLTTFDVTEHPDIAPGDVIELIGPGHDIDAIAAEAGTIGYEILTSLGPRYRRVVKSV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccgaccctgaccatcgaccccggcgccgtcgccgccaactggcaggcgctg
gccgcccgccatgcgggggaggtcgccggcgtggtgaaggcggatgcctacggactcggc
gcggcgctgatcgcccctgccctcgccgctgccggctgccgcagctttttcgtcgccacg
ctggatgaggccctttccctgcgcgccctgttgccggcggcgcggatcggcgtgctcaat
ggctgcccgcccggcgaggaggaaacgatgcgcgcgcgggagctgaggccggttctgggc
tcgctcgcggcctgcgcgcgctggcgcggcgccgctggcgatgacgaggcgccgccttcg
ttcctgcatctcgataccgggatgaaccggctcggcctcgatcgtgacgaggcggcccat
ctcatcgcccatccgactcttctcgacgggctgggcctgacgcatgtgatgacgcatctg
gtcgccgcggaggagccggatgcgtcggcgaatgccgcgcagcgcgagcgtttcgccgct
ttcgccgcgcggttcccctggctgcggaccagccttgccaactcctcgggcctgtttctc
ggccctgggttcggctccgacctcgcgcggccgggctatgcgctctatggcggcaacccg
acaccgacggcggcgaatccgatgcgcccggccatcgccctcgccgcccccatcctgcag
atccgcgcgatcgcttcgggcgagaccgtcggctacaacggcacctggcgggcggcgcgg
ccctcgcgtatcgcgacgatcggcgtcggctatgccgatgggttgccgcggtcgctgtcg
aaccggctgacggcgcgctggcaggggaagatcatcccggtcgcgggcaggctgtcgatg
gacctgacgacgttcgacgtcaccgaacatcccgacatcgcgcccggcgacgtcatcgag
ttgatcggcccgggccatgacatcgatgccatcgccgccgaggccggcacgatcggttac
gagattctgacctcgctcggcccgcgctatcggcgggtcgtgaaatcggtataa

DBGET integrated database retrieval system