KEGG   Acidiphilium multivorum: ACMV_33200Help
Entry
ACMV_33200        CDS       T01446                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
amv  Acidiphilium multivorum
Pathway
amv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACMV_33200
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACMV_33200
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACMV_33200
    1.1.1.-  
     ACMV_33200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAJ82667
NITE: ACMV_33200
UniProt: F0J6Q0
LinkDB All DBs
Position
3616527..3617603
Genome map
AA seq 358 aa AA seqDB search
MKALRFHAARDLRIEDVAAPDRKPPPGQVLVRNRFVGICGTDLHEYAYGPIFIPTTPHPF
TGAQGPQILGHEFGGVVTAIGEGVSSVKPGDRVSVQPLIMPRAGDYYADRGLFHLSPQLA
LAGLSWAWGGMAEEAMLHEYNVQRIPDALSDEEAALVEPAAVAVYSCDRGGVGAGSAVLV
TGAGPIGLLTLIAARAAGATTLFLSDINDARLAFARSILPDIVVLNPQRDDVGSRVRAAT
EGGAGCDVALECVGNEHALKACLDAVRKQGVVVQTGLHPHDNPLDWFQVTFKDVDLRGAW
AYPTHYWPRVIRMIASGILPASKIVTARIRLDDAVAEGFEALLDPSGRHIKILIDLAA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcactacgattccatgccgcccgcgatctgcggatcgaggacgtcgccgcacct
gaccgcaagccaccacccggtcaggtcctcgtgcgcaaccgcttcgtcggcatctgcggc
accgacctgcacgaatacgcctacgggccgatcttcatccccaccacaccgcatcccttc
accggcgcccaggggccgcaaatcctcgggcacgaattcggcggtgtcgtcaccgcgatc
ggcgagggcgtctccagcgtgaagccgggcgaccgcgtctccgtccagcccctgatcatg
ccgcgcgccggcgactattatgccgaccgtggcctgtttcacctcagcccgcagctggcg
ctggccggcctcagctgggcctggggcggcatggccgaggaagcgatgctgcacgaatac
aacgtgcagaggattcccgacgcgctgagcgacgaggaggccgccctggtcgagcccgcc
gccgtcgccgtctattcctgcgaccgcggcggcgtcggcgcgggcagcgcggtgctggtg
acgggcgccgggccgatcggcctgctcaccctgattgccgcccgcgccgccggcgcgacg
acgctcttcctctccgacatcaacgacgcgcggctcgccttcgcccgcagcatccttccc
gacatcgtcgttctcaacccgcagcgcgacgatgtcggctcccgcgtccgtgcggcgacc
gagggcggggcgggctgcgacgtcgccctcgaatgcgtcgggaacgagcacgcgctgaaa
gcctgcctcgatgcggtgcgcaagcagggcgtggtggtccagaccgggcttcacccgcac
gacaatccgctcgactggttccaggtcacgttcaaggatgtcgacctgcggggcgcctgg
gcctacccgacccattactggccgcgcgtgatccgcatgatcgcgagcggcatcctgccc
gcctcgaagatcgtcaccgcccgcatccggctcgacgatgccgttgccgaagggttcgag
gcgctgctcgatccctccggcaggcacatcaagattctcatcgatctcgccgcctga

DBGET integrated database retrieval system