KEGG   Altererythrobacter marensis: AM2010_1151Help
Entry
AM2010_1151       CDS       T03951                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
amx  Altererythrobacter marensis
Pathway
amx00790  Folate biosynthesis
amx01100  Metabolic pathways
Module
amx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AM2010_1151
Enzymes [BR:amx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AM2010_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AKM07225
UniProt: A0A0G3X6P9
LinkDB All DBs
Position
complement(1210916..1212037)
Genome map
AA seq 373 aa AA seqDB search
MSERVYLQPIGLAASPQGEEGDCIRLGGGMVYAHRFAAIVRREGTVVERWRFTPETAAET
LARLPEALGAEAEAQWANLRTSHPPLELGARTVRLDQPQVAGILNVTPDSFSDGGAFLDR
PEHGRDHAAAMLEAGAAIVDIGGESTRPGAAAVWEGEEIERVVPAVEYCAAMGAAISVDT
RRPAVMDAALHAGAHMINDVSALRHDPRSLELVTARDCPVILMHAPGEGEDLHAGGDYDA
VVFDVFDWLRERRDAALAAGVARERIVLDTGIGFGKSLAENLALINALPLFHALGQPLML
GASRKRMIGALSNEAPAHERLGGSLALAIAGMDAGVQLLRVHDVAATVQARNVWRGLRDA
ALTDFSQLPEGAG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacgggtctatctccagcccatcggccttgcggcgagcccgcagggggaggaa
ggcgactgcatccggctgggcggggggatggtctatgcccatcgcttcgccgcgatcgtg
cggcgcgaaggcaccgtggtggaacgctggcgattcacgccggagactgcggcggagacg
ttggcccgcctgcccgaagcgctgggcgcggaggcggaggcgcaatgggcgaacttgcgc
acgtctcatccgccgctcgaactgggcgcgcggaccgtgcggctcgaccagccgcaggtg
gcgggcatactcaacgtcacgcccgacagcttctccgacgggggcgcgttcctcgaccgg
cccgaacacgggcgcgaccatgctgccgccatgctggaggccggggccgccatcgtcgac
atcggcggggaaagcacgcgcccgggcgcggccgcggtatgggaaggggaagagatcgag
cgggtggtccccgcggtcgaatactgcgccgcaatgggcgcggcgatcagcgtcgatacc
cggcggccggcagtgatggacgccgcgctccatgcaggcgcgcacatgatcaacgacgtg
tcggccctgcgccacgatccgcgcagcctcgaactcgtgaccgcgcgcgattgcccggtg
atcctgatgcacgcgccgggcgaaggtgaggaccttcatgccggcggcgattacgacgcg
gtcgtgttcgacgtgttcgactggctgcgcgaacgccgcgatgccgcgctggcggcaggc
gtcgcgcgcgagcggatcgtgcttgatactgggatcggcttcggcaagtcgctggcggaa
aacctcgcgctgatcaacgccctgccgctgttccacgcgctgggccagccgctgatgctg
ggcgccagccgcaagcggatgatcggcgcgctcagcaacgaggcccccgcgcacgagcgg
ctcggcggcagcctggcgctggcgatcgcggggatggacgcgggggtgcagctgctgcgc
gtgcacgacgttgccgccacggttcaggcgcgcaacgtctggcgcggcctgcgcgatgcc
gcgctgaccgacttctcgcaattgccggaaggtgcggggtag

DBGET integrated database retrieval system