KEGG   Altererythrobacter marensis: AM2010_1325Help
Entry
AM2010_1325       CDS       T03951                                 

Definition
(GenBank) Phosphoribosylglycinamide synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amx  Altererythrobacter marensis
Pathway
amx00473  D-Alanine metabolism
amx00550  Peptidoglycan biosynthesis
amx01100  Metabolic pathways
amx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AM2010_1325
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AM2010_1325
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AM2010_1325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amx01011]
    AM2010_1325
Enzymes [BR:amx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AM2010_1325
Peptidoglycan biosynthesis and degradation proteins [BR:amx01011]
 Precursor biosynthesis
  Amino acid ligase
   AM2010_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 GSP_synth
Motif
Other DBs
NCBI-ProteinID: AKM07398
UniProt: A0A0G3XAG8
LinkDB All DBs
Position
1395037..1396026
Genome map
AA seq 329 aa AA seqDB search
MTIDPATKERLRILFIAKNAMWDGDLHPEDGNHALYHREMRQVLEGLGLDLMLADRFEIL
FEDPEVDFVFPLLNRAGFFNSEMLCPLLCERKGIPYLGASPILRGLSDDKHLAKRAARVA
EVPTAPWAIFRRGAPIDLALVPQGERYVIKPNASSASWGVNDATDLASVERAVADVHALG
HDALVEPFLDGSDVEVPVITVRGEPTILPMMIFRQADPSHLRTYQEKRDLVDRSQKYSLD
PFENADMAARIADLTRKAWNEYRPFDYGRFEFRVNEDTGEITFLELNLNCNLWSQKVFGR
AAALAGWSQSQLIETILAESLVRHGLMAQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgacccggcgacgaaggaacggttgcgaatcctgttcatcgctaagaacgcg
atgtgggacggcgatcttcaccccgaagatggcaaccacgcgctctatcatcgcgagatg
cgccaggtgctcgaagggctcggcctcgatctcatgctcgccgaccggttcgagattctg
ttcgaggacccggaagtcgacttcgtctttccgctcctcaatcgggccggcttcttcaat
tcggaaatgctgtgtcctcttctttgcgagcgcaagggcatcccctatcttggcgccagc
ccgatcctgcgcgggctttccgatgacaaacacctcgcgaagcgcgccgcgcgcgtcgcc
gaagtgccgaccgcaccctgggcgattttccgccgcggcgctccgatcgacctggcactg
gtgccgcagggcgagcggtacgtcatcaagcccaacgcatcctcggccagttggggcgtc
aacgatgccaccgatcttgccagcgtggaacgggccgtggccgacgtccacgctctggga
cacgacgctctggtcgaacctttcctcgacggcagcgacgtcgaagtgcccgtcatcacc
gtacgaggcgagcctacgatcctgccgatgatgatcttccgccaggccgatccctcgcat
ttgcgcacataccaggaaaagcgcgacctggtggaccgcagccagaaatactccctcgat
cctttcgagaatgcggacatggccgcacggatagccgacctgacgcgcaaggcgtggaac
gagtatcggccgttcgactatggccggttcgaattccgcgtgaacgaggacacaggcgag
atcacgttcctggaactcaatctcaactgcaatctctggtcgcagaaggtgttcggccgt
gcagcagccttggcgggatggagccagtcgcaattgatcgaaaccatcctggccgaaagc
ctcgtgcgccacgggctgatggcgcagtga

DBGET integrated database retrieval system