KEGG   Altererythrobacter marensis: AM2010_1326Help
Entry
AM2010_1326       CDS       T03951                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
amx  Altererythrobacter marensis
Pathway
amx00020  Citrate cycle (TCA cycle)
amx00190  Oxidative phosphorylation
amx00650  Butanoate metabolism
amx01100  Metabolic pathways
amx01110  Biosynthesis of secondary metabolites
amx01120  Microbial metabolism in diverse environments
amx01130  Biosynthesis of antibiotics
amx01200  Carbon metabolism
Module
amx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM2010_1326
   00650 Butanoate metabolism
    AM2010_1326
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM2010_1326
Enzymes [BR:amx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AM2010_1326
    1.3.5.4  fumarate reductase (quinol)
     AM2010_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AKM07399
UniProt: A0A0G3X9V9
LinkDB All DBs
Position
1396097..1396879
Genome map
AA seq 260 aa AA seqDB search
MATFTLPKNSKISRKGNVHRADGAARVQKFRIYRYDPDSGNNPRYDTFEIDLDDCGPMVL
DALIKIKNEVDPTLTFRRSCREGICGSCSMNMNGKNGLACTTAMEDLKGEIRITPLPHMD
VVKDLVPDFSHFYAQYASIRPWLQTVSTTPSGKERLQSPEQREKLDGLYECILCACCSTA
CPSYWWNSDKFLGPAILLQAYRWLADSRDEMTGERLDALEDPFRLYRCHTIMNCANVCPK
GLNPAKAIGETKKMLVERQI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcaccctccccaagaactccaagatctcgcgcaagggcaatgttcaccgg
gccgatggtgcggcgcgggtccagaagttccggatctatcgctacgaccccgatagcggc
aacaacccgcgttatgacacgttcgagatcgatctcgacgattgcgggccgatggttctc
gacgcactgatcaagatcaagaacgaggtcgacccgacgctgaccttccgccgttcgtgc
cgcgaggggatttgcggatcctgttcaatgaacatgaacggcaagaacggcctcgcctgc
accacggcaatggaagatctgaagggcgaaatccgcatcacccccctgccccacatggac
gtggtgaaggacctggtgcccgatttctcgcacttctacgcccagtatgcttcgatccgc
ccgtggctgcagaccgtctcgaccacgcccagcggcaaggaacggttgcagagccccgaa
cagcgcgagaagctggacggcctctacgaatgcatcctgtgcgcctgctgctccaccgcg
tgccccagctactggtggaattcggacaagttcctcggcccggcgatcctgctccaggcc
tatcgctggctggccgacagccgcgacgaaatgaccggtgagcggctcgacgcactggaa
gacccgttccggctctatcgctgtcacacgatcatgaactgcgccaacgtgtgccccaag
gggctcaacccggccaaggcgatcggcgaaaccaagaagatgctggtcgagcgccagatc
tga

DBGET integrated database retrieval system