KEGG   Altererythrobacter marensis: AM2010_1398Help
Entry
AM2010_1398       CDS       T03951                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amx  Altererythrobacter marensis
Pathway
amx00020  Citrate cycle (TCA cycle)
amx00190  Oxidative phosphorylation
amx00650  Butanoate metabolism
amx01100  Metabolic pathways
amx01110  Biosynthesis of secondary metabolites
amx01120  Microbial metabolism in diverse environments
amx01130  Biosynthesis of antibiotics
amx01200  Carbon metabolism
Module
amx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM2010_1398
   00650 Butanoate metabolism
    AM2010_1398
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM2010_1398
Enzymes [BR:amx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AM2010_1398
    1.3.5.4  fumarate reductase (quinol)
     AM2010_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AKM07470
UniProt: A0A0G3X7C0
LinkDB All DBs
Position
complement(1459854..1461713)
Genome map
AA seq 619 aa AA seqDB search
MSNPAPQTASNNTTGPAYAIVDHTYDVVVVGAGGSGLRATMGAAEAGLKTACITKVFPTR
SHTVAAQGGIAASLGNNTPDHWSWHMYDTVKGSDWLGDQDAIEYMVREAPQAVYELEHAG
VPFSRNDNGTIYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFI
EYFALDLIMENDASGVPQCRGVIAMCLDDGTIHRFRAKAVVLATGGYGRCYYTATSAHTC
TGDGGGMVLRAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAP
SAKDLASRDVVSRSMALEMREGRGVGPEKDHIFLHLDHIDPKVLAERLPGITESGKIFAG
VDLTRQPLPVTPTVHYNMGGIPCNYHGEVVTIGPDGNPETVVPGLFAVGEAACVSVHGAN
RLGSNSLIDLVVFGRATGHRLKELIKPGTSHDELPKDSADLALTRLDHFRHASGGSPTAE
IRAEMQKNMQKHAAVFRDSKLLTEGVELLKQVNKRMEDIHVSDRSLIWNSDLVETLELDN
LMAQANVTIASAENRKESRGAHAHEDFPDRDDANWMKHTAVWFEGWGGNGGEMKIDYRPV
HEYTLTDDAEYITPKKRVY
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccggcaccccagaccgccagcaataacaccaccggcccggcctatgcgatc
gtcgatcacacttatgacgtggtcgtcgtgggcgcgggcggatcgggcctgcgcgccacc
atgggcgcggccgaagcgggcctgaagacggcctgcatcaccaaggtcttccccacccgc
agccataccgttgccgcgcagggcgggatcgcggccagcctgggcaacaacacgcccgat
cactggtcgtggcacatgtacgataccgtcaagggttccgactggctcggcgatcaggac
gcgatcgaatacatggtgcgcgaggcgccgcaggcggtttacgagctggaacatgccggc
gtgccgttcagccgcaacgataacgggacgatctatcagcgcccgttcggcggccacatg
cagaacatgggcgaaggcccgccggtgcagcgcacctgcgccgccgccgaccgcaccggc
cacgccatgcttcacgcgctctaccagcagagcctgaagtacgacgcggacttcttcatc
gagtatttcgcgctcgacctgatcatggaaaacgacgccagcggcgtgccgcagtgccgc
ggcgtgatcgcgatgtgcctcgacgacgggacgatccaccgcttccgcgccaaggcggtc
gtgctggcgaccggcggctatggccgctgctactacaccgccaccagcgcgcatacctgc
accggcgatggcggcggcatggtcctgcgcgcgggcctgccgctgcaggacatggaattc
gtccagttccaccccaccggcatctacggcgcgggcgtgctcattaccgagggcgcacgg
ggcgagggcggctacctgacgaactcggaaggggagcgtttcatggaacgctacgccccg
agtgccaaggatctcgccagccgcgacgtcgtgtcgcgctcgatggcgctggaaatgcgc
gaagggcgcggtgtcgggccagagaaggatcatatcttcctccacctcgatcacatcgat
cccaaggttctggcagagcgtctgcccggcattaccgaaagcggcaagatcttcgccggc
gtggacctgacgcgccagccgctgccggtgacgccgaccgtgcattacaacatgggcggc
attccctgtaactatcacggcgaagtcgtaaccatcgggccggacggcaacccggaaacc
gtggtcccgggcctgttcgcggtgggcgaggcggcctgcgtttcggtccacggggcgaac
cgcctcggctcgaactcgctgatcgacctcgtggtgttcggccgcgcgactggccaccgg
ctgaaggaactgatcaagccgggcaccagccatgacgagctgcccaaggacagcgccgat
ctcgcgctgacccggctcgaccatttccgccacgccagcggcggatcgccgacggcggaa
atccgcgcggaaatgcagaagaacatgcagaagcacgccgccgtcttccgcgacagcaaa
ctgctgaccgaaggggtcgaactgctgaagcaggtgaacaagcggatggaggatatccat
gtctccgaccgctcgctgatctggaacagcgaccttgtcgaaacgctcgagctcgacaat
ctgatggcccaggccaacgtcaccatcgcttcggccgaaaaccgcaaggaaagccgcggc
gcccacgcgcacgaggatttccccgatcgcgacgatgcgaactggatgaagcacaccgcc
gtctggttcgaaggctggggcggcaacggcggcgagatgaagatcgattaccgcccggtg
cacgaatacacgctcaccgacgatgccgagtacatcacaccgaagaagcgcgtttactaa

DBGET integrated database retrieval system