KEGG   Altererythrobacter marensis: AM2010_2477Help
Entry
AM2010_2477       CDS       T03951                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
amx  Altererythrobacter marensis
Pathway
amx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:amx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AM2010_2477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amx03400]
    AM2010_2477
Enzymes [BR:amx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AM2010_2477
DNA repair and recombination proteins [BR:amx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AM2010_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKM08532
UniProt: A0A0G3XBK9
LinkDB All DBs
Position
2636641..2639190
Genome map
AA seq 849 aa AA seqDB search
MSRRDPLAEYNRKRDFSKTAEPAGERAGGEGGSRFIVQKHAASRLHWDFRLEADGVLKSW
AVTKGPCPDPDVKRLAVRTEDHPMSYADFEGTIPKGEYGGGTVMLWDRGTWAPVEGKSWK
DIEKGHLHFTLDGERMKGEWLLVRMKKKPGEKRENWLLRKIEDEHAEPGDTLVERELTSV
LTGRAMAEIAADKQGEHSLEGKSGRAFAREMAKAGENNAKKAAKAKKKPARKGGAGKPPA
FRKLQLATLVDAVPAGNGWMHEIKFDGYRALIAAAGGTVRVYTRSGKDWSEKFAPLARAF
AALDLPACLIDGEIVAYDTAGNPDFSSLQRVLKRGHGAQGESDRLAFHGFDLLEADGEDL
TGLPNVERKERLEALLEGVEAPIHVADHVIGAGEKLYRAMCDAAQEGIISKTIDAPYRGS
RTRNWVKVKCTLRQEFVIVGWKASSAKGRPFASLLLAQHEGSGEDARLVYKGNVGTGFSH
ETLEDMAAKMKRLERKTPPVEVDRASARQVTWVTPKLVAEIAFSEFTADGNVRHGSFLGL
RSDKDADEVRPEKAGSAPDTGAAQDVEISSRERVIFPDAKCTKGDLADYYADVAPLMLPF
AAQRPVSLVRCPQGRAKKCFFQKHDSGSFGPHVRHVPIAEKKGGTEDYLYLEDAAGLLAC
VQMGTIEFHGWAARSGDVERPDRMIFDLDPDEGLDFADVKQAAEDLRRKLADIGLTSHAM
LTGGKGVHVVVPLTPGHSWEVHKDFASRFAEALSMAEPDRFTATMSKAKRKGKIFIDWLR
NQRGSTAVVPYSARAREGAPVAAPIAWGELKSFGDAKPFTIADAAKLHARAKSKSLAGWG
FAEQRLPDI
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggcgcgaccccctggccgaatacaatcgcaagcgcgatttctcgaagaccgcg
gaaccggcgggggagcgcgccgggggcgaaggcggcagtcgcttcatcgtccagaagcac
gcggccagccgccttcactgggatttccggctggaagccgacggcgtgctcaagtcctgg
gccgtgaccaaggggccgtgtcccgatcccgacgtcaagcgcctggccgtgcggaccgag
gatcacccgatgtcctacgccgatttcgaaggcacgatcccgaagggcgaatatggcggc
ggcacggtcatgctgtgggatcgcggcacctgggccccggtggaaggcaagagctggaag
gatatcgaaaagggccacctgcacttcactctcgatggagagcggatgaagggcgaatgg
ctgctcgtgcgcatgaagaagaagccgggtgaaaagcgcgaaaactggctcctgcgcaag
atcgaagacgaacatgccgaacccggcgacacgctggtggagcgcgagctgaccagcgtc
ctgaccggccgcgcgatggcggaaatcgccgccgacaagcagggcgagcactcgctcgaa
ggcaagtcgggccgggcattcgcaagggaaatggccaaggcgggcgaaaacaacgcgaag
aaggcggcgaaagcgaagaagaagccggcgcgcaaggggggcgccggcaagccaccggca
tttcgcaagctgcaactggccacgctggtcgatgcggtgcccgcgggcaatggctggatg
cacgagatcaagttcgacggttatcgcgcgctgatcgccgctgcgggcgggacggtgcgc
gtctatacccgcagcggcaaggactggagcgaaaagttcgccccgcttgcccgcgccttc
gccgcgctcgacctgccggcctgcctgatcgacggggagatcgtcgcttacgataccgcg
ggcaatcccgatttctcctcgctccagcgcgtgctcaagcgcgggcacggcgcgcagggg
gaaagcgaccggctcgccttccatggcttcgacctgctcgaagccgatggcgaggacctg
accggcctgcccaatgtcgagcgcaaggaacggctggaggcgctgctcgaaggggtcgag
gcgccgatccacgtcgccgatcacgtgatcggcgcgggggagaagctctaccgcgcgatg
tgcgacgcggcgcaggaagggatcatctccaagacgatcgacgccccctatcgcggcagc
cggacgcgcaactgggtgaaggtcaagtgcacgctgcgtcaggaattcgtgatcgtcgga
tggaaggcgtcgagcgcgaaaggccgccccttcgcctcgcttctgctggcccagcacgaa
ggatcgggcgaggatgcgcggctcgtctacaagggcaatgtcgggaccggcttctcgcac
gagacgctggaggacatggcggcgaagatgaagcggctggagcgcaagacgcccccggtc
gaggtcgatcgcgcttccgctcgccaggtcacctgggtgacgccgaaactggtcgcggaa
atcgccttcagcgaattcaccgccgacggcaatgtccgccacggcagcttcctcggtctg
cgcagcgacaaggacgcggacgaggtccggccggagaaggcaggcagcgcacctgacacc
ggggccgcgcaggacgtggagatatcgagccgcgagcgggtgatcttccccgatgcgaag
tgcaccaagggcgatctggccgattactacgccgatgtcgcgccgctgatgctgcctttc
gcggcccagcgcccggtcagcctggtccgctgcccccaggggcgggcgaagaagtgcttc
ttccagaaacatgacagcggatcgttcggcccccacgtcaggcacgtgccgatcgcggag
aagaagggcgggaccgaggactatctctacctggaggatgccgcgggcctgctcgcctgc
gtgcagatgggcacgatcgaattccacggctgggccgcgcgcagcggcgatgtcgagcgg
cccgaccggatgatcttcgacctcgacccggacgaagggctggatttcgccgacgtgaaa
caggccgcggaggacctgcgccgcaagctggccgatatcgggctgaccagccatgccatg
ctgaccggtggcaagggggtgcacgttgtcgtgccgttgacccccggccattcgtgggag
gtgcacaaggatttcgccagccgctttgccgaggcgctgagcatggccgaacccgatcgc
ttcaccgcgacgatgagcaaggcgaaacgcaagggcaagatcttcatcgactggctgcgc
aaccagcgcggcagcaccgcggtcgtcccctattcggcgcgcgcgcgcgaaggggcgccg
gtggccgcgccgatcgcctggggcgagttgaaatcgttcggcgatgccaagccgttcacg
atcgccgacgcggcgaagctgcacgcgcgcgcgaagtcgaaatcgctcgccgggtggggc
tttgccgagcagcgcctgcccgatatctag

DBGET integrated database retrieval system