KEGG   Altererythrobacter marensis: AM2010_2686Help
Entry
AM2010_2686       CDS       T03951                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, subunit f
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amx  Altererythrobacter marensis
Brite
KEGG Orthology (KO) [BR:amx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AM2010_2686
Enzymes [BR:amx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AM2010_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored DAO HI0933_like Thi4 FAD_binding_3 K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AKM08741
UniProt: A0A0G3XDN4
LinkDB All DBs
Position
2869928..2871514
Genome map
AA seq 528 aa AA seqDB search
MLDTAMQQQLKQYLANLREPIELVASLGDDAKSEETRALLTEIAGLHDMVSASFDGTDER
RPSFIIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDPETLEAIARLEGDYN
FEMYFSLSCHNCPDVVQALTLMALTNSRITATLIEGGTFKDEVDARDVMAVPATFLNGEP
FFNGKMNVDDILARLDSGAGERQAAKLAEKEPFDVLVVGGGPAGASAAIYTARKGFVTGI
AAERFGGQLHDTLGIENLTGTTYTEGPKLAAQLESHVGEYDIDLMDRLQAEKLIPASEPG
GMHEVVFANGASLKTRALILATGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAKIVGHVTLIEFDTKLRADEVLQAKLHSMPNVTVLTNAQTTEITGA
DGRVNGLVYKDRASGEEHRVELEGVFVQIGLVPNTEWLKDSGLGLSKFGEIAIDGNAATD
LPGVFGAGDCTTVPYKQIVVAMGEGSKAALSAFDYLIRNEPAEVAEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccgcaatgcagcagcagctcaagcaatacctcgccaacctgcgcgagccg
atagagctggtcgcctcgctgggcgacgatgccaagtcggaagaaacgcgcgctctcctg
accgagatcgcgggcctgcacgacatggtttccgccagcttcgacggtacggacgagcgg
cggcccagcttcatcatccgccgcgcttcggacgcggaaaagtgggtccgtttcgccggc
ctgccgatggggcacgagttcacctcgctggtgctcgccctgctctgggccggcggccat
ccgcccaaggtcgaccccgaaacgctggaggcgattgcccggctggaaggggattacaac
ttcgagatgtatttctcgctctcgtgccacaactgccccgacgtggtgcaggcgctgacg
ctgatggcgctgaccaattcgcggatcaccgcgaccctgatcgaaggcggcacgttcaag
gacgaagtcgacgcgcgcgacgtcatggccgtgcccgcgacgttcctgaacggggagccg
ttcttcaacggcaagatgaatgtcgacgacatcctcgcccggctcgacagcggagcgggc
gagcggcaggcggcgaagctggcggaaaaggagccgttcgacgtgctcgtcgtcggcggc
ggcccggcgggtgcctcggccgcgatctataccgcgcgcaagggtttcgtcaccggcatc
gcggccgaacgcttcggcgggcagctgcacgatacgctggggatcgagaacctgaccggc
acgacctataccgaagggccgaagctggccgcgcagctcgaaagccatgtcggcgaatac
gacatcgacctgatggaccggctccaggccgaaaagctgatccccgccagcgaaccgggc
gggatgcacgaagtggtcttcgccaatggcgcctcgctgaaaacgcgcgcgctgatcctc
gccaccggggcgcgctggcgcaacctcggcgtgccgggggaggcggaatatcgcaacaag
ggtgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcggatcgcggtg
atcggcggcggcaattcgggcgtcgaggcggcgatcgacctggccaagatcgtcggccat
gtgacgctgatcgaattcgatacgaagctgcgcgcggacgaggtgctgcaggccaagctg
cacagcatgcccaacgtcaccgtgctgaccaatgcccagacgaccgagatcaccggagcc
gacgggcgggtcaacggcctggtctacaaggaccgcgccagcggcgaggagcatcgggtg
gagctggaaggcgtgttcgtccagatcggtctcgtccccaatacagagtggctgaaggac
agtggtctggggctgagcaagttcggcgagatcgcgatcgacggcaatgccgcgaccgat
ctgcccggcgtgttcggggccggcgactgcacgactgtgccctacaagcagatcgtggtc
gcgatgggcgaaggttcgaaagcggcgctgagcgcgttcgattacctcattcgcaacgaa
cctgccgaagtggcggaagcggcctga

DBGET integrated database retrieval system